DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32485 and AT1G75370

DIOPT Version :9

Sequence 1:NP_728794.1 Gene:CG32485 / 38363 FlyBaseID:FBgn0052485 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_001154472.1 Gene:AT1G75370 / 843873 AraportID:AT1G75370 Length:668 Species:Arabidopsis thaliana


Alignment Length:253 Identity:66/253 - (26%)
Similarity:109/253 - (43%) Gaps:55/253 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 EELAPINEQDFKDLKERMKLIVEADPKQYHNDFSLRRYLRAFKTTDDAFQAILKTN--KWRETYG 66
            |||..::|  |::|.....|:    |....:...:.|:|:|.| .|.....::.:|  |||:.:|
plant    86 EELRAVDE--FRNLLVSENLL----PPTLDDYHIMLRFLKARK-FDIGKTKLMWSNMIKWRKDFG 143

  Fly    67 VDKLSE-MDRSQLDKKARLLRHR----DCIGRPVIYI-------PAKNHSSERDIDELTRFIVYN 119
            .|.:.| .:..:.|:..:...|.    |..|||| ||       |||    ...:..:.|||.|:
plant   144 TDTIFEDFEFEEFDEVLKYYPHGYHGVDKEGRPV-YIERLGLVDPAK----LMQVTTVERFIRYH 203

  Fly   120 LEEACKKCFEEVTD----RLCIVFDL-AEFSTSCMDYQLV---------QNLIWLLGK----HFP 166
            :.|     ||:..:    ..||.... .:.||:.:|.|.|         ::||..|.|    ::|
plant   204 VRE-----FEKTVNIKLPACCIAAKRHIDSSTTILDVQGVGFKNFSKPARDLIIQLQKIDNDNYP 263

  Fly   167 ERLGVCLIINSPGLFSTIWPAIRVLLDDNTAKKVKFVAD--EAELCQYL----IPDIL 218
            |.|....|||....|..:|..::..||..|..|:..:.:  :.:|.:.:    :||.|
plant   264 ETLHRMFIINGGSGFKLVWATVKQFLDPKTVTKIHVIGNKYQNKLLEIIDASQLPDFL 321

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32485NP_728794.1 CRAL_TRIO 85..219 CDD:279044 45/169 (27%)
AT1G75370NP_001154472.1 CRAL_TRIO_N 89..135 CDD:215024 10/52 (19%)
SEC14 159..324 CDD:238099 45/173 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1133487at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.