DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32485 and AT1G55840

DIOPT Version :9

Sequence 1:NP_728794.1 Gene:CG32485 / 38363 FlyBaseID:FBgn0052485 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_175980.1 Gene:AT1G55840 / 842034 AraportID:AT1G55840 Length:325 Species:Arabidopsis thaliana


Alignment Length:240 Identity:55/240 - (22%)
Similarity:100/240 - (41%) Gaps:35/240 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 NEQDFKDLKERMKLIVEADPKQY---HNDFSLRRYLRAFKTTD----DAFQAILKTNKWRETYGV 67
            ||:..|.|:..|:.:.::..:.|   |..:.....||..|..|    .|.:.:|:..:||....:
plant     5 NEEAVKQLRALMEDVDDSLRESYRNIHQGYPTENLLRFLKARDGNVQKAHKMLLECLEWRTQNEI 69

  Fly    68 DKLSEMDRSQLDKKARLLRHRDCI--------GRPVI--------YIPAKNH---SSERDIDELT 113
            ||:.......:| ..|.:|....:        |.|||        |..|..|   .|...::|..
plant    70 DKILTKPIVPVD-LYRGIRDTQLVGVSGYSKEGLPVIAIGVGLSTYDKASVHYYVQSHIQMNEYR 133

  Fly   114 RFIVYNLEEACKKCFEEVTDRLCI-VFDLAEFSTSCM-DYQLVQNLIWLLGKHFPERLGVCLIIN 176
            ..:|  |..|.||....:.  .|: :.|::....|.: ..:|:..:..:...::||:.....::|
plant   134 DRVV--LPSASKKQGRPIC--TCLKILDMSGLKLSALSQIKLMTAITTIDDLNYPEKTETYYVVN 194

  Fly   177 SPGLFSTIWPAIRVLLDDNTAKKVKFV--ADEAELCQYLIPDILP 219
            .|.:||..|..|:.||.:.|.||::.:  ..:.||.:.:..:.||
plant   195 VPYIFSACWKTIKPLLQERTKKKIQVLKGCGKDELLKIMDYESLP 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32485NP_728794.1 CRAL_TRIO 85..219 CDD:279044 34/156 (22%)
AT1G55840NP_175980.1 CRAL_TRIO_N 8..59 CDD:397711 10/50 (20%)
SEC14 91..242 CDD:214706 35/153 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1133487at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.