DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32485 and AT1G01630

DIOPT Version :9

Sequence 1:NP_728794.1 Gene:CG32485 / 38363 FlyBaseID:FBgn0052485 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_171669.1 Gene:AT1G01630 / 839231 AraportID:AT1G01630 Length:255 Species:Arabidopsis thaliana


Alignment Length:245 Identity:67/245 - (27%)
Similarity:107/245 - (43%) Gaps:53/245 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 SSEELAPINEQDFKDLKERMKL-IVEA-----DPKQYH-NDFSLRRYLRAFKTTDDAFQAILKTN 59
            :.::..|:.|.:.    ||.|: |:.|     ||:... :|..:||:|||               
plant    14 AEQKTVPLIEDEI----ERSKVGIMRALCDRQDPETKEVDDLMIRRFLRA--------------- 59

  Fly    60 KWRETYGVDKLSEM-------DRSQLDKK-------ARLLRH-------RDCIGRPV-IYIPAKN 102
               ....::|.|.|       .||.|.|.       |..|.|       .|.:|||: :.|..::
plant    60 ---RDLDIEKASTMFLNYLTWKRSMLPKGHIPEAEIANDLSHNKMCMQGHDKMGRPIAVAIGNRH 121

  Fly   103 HSSERDIDELTRFIVYNLEEACKKCFEEVTDRLCIVFDLAEFSTSCMDYQLVQNLIWLLGKHFPE 167
            :.|:.:.||..||:||.||:.|.: .....::...:.||..:..|..|.:.....:..|...:||
plant   122 NPSKGNPDEFKRFVVYTLEKICAR-MPRGQEKFVAIGDLQGWGYSNCDIRGYLAALSTLQDCYPE 185

  Fly   168 RLGVCLIINSPGLFSTIWPAIRVLLDDNTAKKVKFVADEAELCQYLIPDI 217
            |||...|:::|.:|.|.|..|...:|.||.||:.|| :..:|...|:.||
plant   186 RLGKLYIVHAPYIFMTAWKVIYPFIDANTKKKIVFV-ENKKLTPTLLEDI 234

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32485NP_728794.1 CRAL_TRIO 85..219 CDD:279044 44/141 (31%)
AT1G01630NP_171669.1 CRAL_TRIO_N 29..74 CDD:215024 14/62 (23%)
SEC14 103..246 CDD:238099 42/134 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 66 1.000 Domainoid score I3571
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 68 1.000 Inparanoid score I2486
OMA 1 1.010 - - QHG53872
OrthoDB 1 1.010 - - D1133487at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_101230
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
76.880

Return to query results.
Submit another query.