DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32485 and AT1G19650

DIOPT Version :9

Sequence 1:NP_728794.1 Gene:CG32485 / 38363 FlyBaseID:FBgn0052485 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_564092.1 Gene:AT1G19650 / 838552 AraportID:AT1G19650 Length:608 Species:Arabidopsis thaliana


Alignment Length:235 Identity:61/235 - (25%)
Similarity:100/235 - (42%) Gaps:62/235 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 SEELAPINEQDFKDLKERMKLIVEADPKQYHNDFSLRRYLRAFKTTDDAFQAILKTN--KWRETY 65
            |:.|.|.|..|                  ||   .:.|:|.|.| .|.....::.||  :||..:
plant    91 SDHLLPPNLDD------------------YH---IMLRFLFARK-FDLGKAKLMWTNMIQWRRDF 133

  Fly    66 GVDK-LSEMDRSQLDKKARLLRHR-------DCIGRPVIYIP--AKNHSSE-RDIDELTRFIVYN 119
            |.|. |.:.:..:||:   :||:.       |..|||| ||.  .|..:|: ..:..|.|::.|:
plant   134 GTDTILEDFEFPELDE---VLRYYPQGYHGVDKEGRPV-YIERLGKVDASKLMQVTTLERYLRYH 194

  Fly   120 LEEACKKCFEE-VTDRL---CIVFDL-AEFSTSCMDYQ---------LVQNLIWLLGK----HFP 166
            ::|     ||: :|.:.   ||.... .:.||:.:|.|         ..::||..|.|    ::|
plant   195 VKE-----FEKTITVKFPACCIAAKRHIDSSTTILDVQGLGLKNFTKTARDLIIQLQKIDSDNYP 254

  Fly   167 ERLGVCLIINSPGLFSTIWPAIRVLLDDNTAKKVKFVADE 206
            |.|....|||:...|..:|..::..||..|..|:..:.::
plant   255 ETLHRMFIINAGSGFKLLWGTVKSFLDPKTVSKIHVLGNK 294

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32485NP_728794.1 CRAL_TRIO 85..219 CDD:279044 40/150 (27%)
AT1G19650NP_564092.1 CRAL_TRIO_N 82..126 CDD:215024 13/56 (23%)
SEC14 146..316 CDD:214706 42/158 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1133487at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.