DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32485 and AT5G63060

DIOPT Version :9

Sequence 1:NP_728794.1 Gene:CG32485 / 38363 FlyBaseID:FBgn0052485 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_201111.2 Gene:AT5G63060 / 836426 AraportID:AT5G63060 Length:263 Species:Arabidopsis thaliana


Alignment Length:186 Identity:54/186 - (29%)
Similarity:89/186 - (47%) Gaps:10/186 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 RRYLRAFKTTDDAFQAILKTNKWRETYGVDKLSEMD-RSQLDK-KARLLRHRDCIGRPVIYI-PA 100
            ||:     :.|:|...:.|..|||..:.||:|||.. ::..|. ||.:....|..||||:.: ||
plant    82 RRF-----SVDEAIGKLTKAIKWRHEFKVDELSEDSIKAATDTGKAYVHGFLDVKGRPVVIVAPA 141

  Fly   101 KNHSSERDIDELTRFIVYNLEEACKKCFEEVTDRLCIVFDLAEFSTSCMDYQLVQNLIWLLGKHF 165
            |:.....|..|..:..|:.||:|..| ......::..:|||..|.:...|.:.:..|..:...::
plant   142 KHIPGLLDPIEDEKLCVFLLEKALSK-LPAGQHKILGIFDLRGFGSQNADLKFLTFLFDVFYYYY 205

  Fly   166 PERLGVCLIINSPGLFSTIWPAIRVLLDDNTAKKVKFVADEAELCQYLIPDILPTD 221
            |.||...|.:::|.:|..||...:.|: ...|..|||.:.|....:|...:.||::
plant   206 PSRLDEVLFVDAPFIFQPIWQFTKPLV-KQYASLVKFCSAETVRKEYFTEETLPSN 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32485NP_728794.1 CRAL_TRIO 85..219 CDD:279044 36/134 (27%)
AT5G63060NP_201111.2 SEC14 118..261 CDD:214706 41/145 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1133487at2759
OrthoFinder 1 1.000 - - FOG0002427
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_101230
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.