DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32485 and AT5G47730

DIOPT Version :9

Sequence 1:NP_728794.1 Gene:CG32485 / 38363 FlyBaseID:FBgn0052485 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_001330995.1 Gene:AT5G47730 / 834824 AraportID:AT5G47730 Length:341 Species:Arabidopsis thaliana


Alignment Length:220 Identity:51/220 - (23%)
Similarity:88/220 - (40%) Gaps:33/220 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 INEQDFKDLKERMKLIVEADPKQY---HNDFSLRRYLRAFKTTDD-----AFQAILKTNKWRETY 65
            ::|:...:.:|.|..:.|...|.|   |..: ||..|..|....|     |...:::..:||...
plant     4 VSEEAIDEFQELMDQVEEPLKKTYERVHQGY-LRENLGRFLKARDWNVCKAHTMLVECLRWRVDN 67

  Fly    66 GVDKL-------SEMDRSQLDKKARLLRHRDCIGRPVIYI--------PAKNH---SSERDIDEL 112
            .:|.:       :|:.|...|.:...:......|.||..|        .|..|   .|...|:|.
plant    68 EIDSILSKPIVPTELYRDVRDSQLIGMSGYTKEGLPVFAIGVGLSTFDKASVHYYVQSHIQINEY 132

  Fly   113 TRFIVYNLEEACKKCFEEVTDRLCI-VFDLAEFSTSCM-DYQLVQNLIWLLGKHFPERLGVCLII 175
            ...::  |....||....:|  .|: |.|:.....|.: ..:||..:..:...::||:.....::
plant   133 RDRVL--LPSISKKNGRPIT--TCVKVLDMTGLKLSALSQIKLVTIISTIDDLNYPEKTNTYYVV 193

  Fly   176 NSPGLFSTIWPAIRVLLDDNTAKKV 200
            |:|.:||..|..::.||.:.|.|||
plant   194 NAPYIFSACWKVVKPLLQERTRKKV 218

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32485NP_728794.1 CRAL_TRIO 85..219 CDD:279044 32/129 (25%)
AT5G47730NP_001330995.1 CRAL_TRIO_N 8..59 CDD:397711 12/51 (24%)
SEC14 91..242 CDD:214706 32/132 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1133487at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.