DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32485 and AT4G39170

DIOPT Version :9

Sequence 1:NP_728794.1 Gene:CG32485 / 38363 FlyBaseID:FBgn0052485 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_568054.1 Gene:AT4G39170 / 830072 AraportID:AT4G39170 Length:614 Species:Arabidopsis thaliana


Alignment Length:256 Identity:61/256 - (23%)
Similarity:112/256 - (43%) Gaps:48/256 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 SSEELAPINEQDFKDLKE-------RMKLIVEADPKQYHNDFSLR-RYLRAFK-TTDDAFQAILK 57
            |...::.::.:|.:|::|       |..|::|......|:|:.:. |:|:|.| ..:.|......
plant    65 SDVRVSSVSIEDVRDVEELQAVDEFRQALVMEELLPHKHDDYHMMLRFLKARKFDIEKAKHMWAD 129

  Fly    58 TNKWRETYGVDK-LSEMDRSQLDKKARLLRHR----DCIGRPVIYIPAKNHSSERDIDELT---R 114
            ..:||:.:|.|. :.:....::|:..:...|.    |..|||| ||..........:.::|   |
plant   130 MIQWRKEFGTDTIIQDFQFEEIDEVLKYYPHGYHSVDKEGRPV-YIERLGKVDPNKLMQVTTLDR 193

  Fly   115 FIVYNLEE----------ACKKCFEEVTDRLCIVFD-----LAEFSTSCMDYQLVQNLIWLLGKH 164
            :|.|:::|          ||....::..|....:.|     |..|:.|..  :|:..|..:.|.:
plant   194 YIRYHVKEFERSFMLKFPACTIAAKKYIDSSTTILDVQGVGLKNFTKSAR--ELITRLQKIDGDN 256

  Fly   165 FPERLGVCLIINS-PGLFSTIWPAIRVLLDDNTAKKV-----KF------VADEAELCQYL 213
            :||.|....|||: || |..:|..::..||..|..|:     |:      :.|.:||.::|
plant   257 YPETLHQMFIINAGPG-FRLLWSTVKSFLDPKTTSKIHVLGCKYQSKLLEIIDSSELPEFL 316

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32485NP_728794.1 CRAL_TRIO 85..219 CDD:279044 42/163 (26%)
AT4G39170NP_568054.1 CRAL_TRIO_N 84..130 CDD:215024 10/45 (22%)
SEC14 150..318 CDD:214706 43/171 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1133487at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.