DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32485 and AT4G36640

DIOPT Version :9

Sequence 1:NP_728794.1 Gene:CG32485 / 38363 FlyBaseID:FBgn0052485 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_001329225.1 Gene:AT4G36640 / 829816 AraportID:AT4G36640 Length:294 Species:Arabidopsis thaliana


Alignment Length:208 Identity:64/208 - (30%)
Similarity:102/208 - (49%) Gaps:22/208 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 NEQDFKDLKERMKLIVEADPKQYH-----NDFSLRRYLRAFK-TTDDAFQAILKTNKWRETYGVD 68
            |:...:|.|.| :|.....|...|     :|.||||:|.|.. ..:.|.:.|.:|.|||.||   
plant    12 NDDSQQDNKVR-ELKSAIGPLSGHSLVFCSDASLRRFLDARNWDVEKAKKMIQETLKWRSTY--- 72

  Fly    69 KLSEMDRSQL------DKKARLLRHRDCIGRPVIYI-PAKNHSSERDIDELTRFIVYNLEEACKK 126
            |..|:..:|:      .|.:|...| |..||.|:.: ||..:|:.::.:  .|.:||.||.|...
plant    73 KPQEIRWNQVAHEGETGKASRASFH-DRQGRVVLIMRPAMQNSTSQEGN--IRHLVYLLENAIIN 134

  Fly   127 CFEEVTDRLCIVFDLAEFSTSC-MDYQLVQNLIWLLGKHFPERLGVCLIINSPGLFSTIWPAIRV 190
             ..:...::..:.|...:|.:. ...:..:.:|.:|..::|||||:..:.|.|.||..::.|.:.
plant   135 -LPKGQKQMSWLIDFTGWSMAVNPPMKTTREIIHILQNYYPERLGIAFLYNPPRLFQAVYRAAKY 198

  Fly   191 LLDDNTAKKVKFV 203
            .||..||:|||||
plant   199 FLDPRTAEKVKFV 211

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32485NP_728794.1 CRAL_TRIO 85..219 CDD:279044 37/121 (31%)
AT4G36640NP_001329225.1 CRAL_TRIO_N 20..65 CDD:215024 14/45 (31%)
SEC14 85..238 CDD:214706 39/131 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45824
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.