DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32485 and SFH12

DIOPT Version :9

Sequence 1:NP_728794.1 Gene:CG32485 / 38363 FlyBaseID:FBgn0052485 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_568006.1 Gene:SFH12 / 829801 AraportID:AT4G36490 Length:543 Species:Arabidopsis thaliana


Alignment Length:259 Identity:64/259 - (24%)
Similarity:116/259 - (44%) Gaps:57/259 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSSEELAPINEQDFKDLKE----RMKLIVEADPKQYHNDFSLR-RYLRAFK----TTDDAFQAIL 56
            ||.|.:..::  |.::||.    |..||::....:.|:|:.:. |:|:|.|    .|...:..:|
plant    39 MSVEIIEDVH--DAEELKAVDAFRQSLILDELLPEKHDDYHMMLRFLKARKFDLEKTKQMWTEML 101

  Fly    57 KTNKWRETYGVDK-LSEMDRSQLDKKARLLRHR-------DCIGRPVIYIPAKNHSSERDIDELT 113
               :||:.:|.|. :.|.|..::|:   :|::.       |..|||| ||..........:.::|
plant   102 ---RWRKEFGADTVMEEFDFKEIDE---VLKYYPQGHHGVDKEGRPV-YIERLGLVDSTKLMQVT 159

  Fly   114 ---RFIVYNLEE----------ACKKCFEEVTDRLCIVFD-----LAEFSTSCMDYQLVQNLIWL 160
               |::.|::.|          ||....::..|:...:.|     |..|:.:..|  |:..|..:
plant   160 TMDRYVNYHVMEFERTFNVKFPACSIAAKKHIDQSTTILDVQGVGLKNFNKAARD--LITRLQKV 222

  Fly   161 LGKHFPERLGVCLIINSPGLFSTIWPAIRVLLDDNTAKKV-----KF------VADEAELCQYL 213
            .|.::||.|....|||:...|..:|..::..||..|..|:     |:      :.||:||.::|
plant   223 DGDNYPETLNRMFIINAGSGFRMLWNTVKSFLDPKTTAKIHVLGNKYQSKLLEIIDESELPEFL 286

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32485NP_728794.1 CRAL_TRIO 85..219 CDD:279044 40/165 (24%)
SFH12NP_568006.1 CRAL_TRIO_N 54..100 CDD:215024 11/45 (24%)
SEC14 120..290 CDD:214706 41/173 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1133487at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.