DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32485 and AT4G08690

DIOPT Version :9

Sequence 1:NP_728794.1 Gene:CG32485 / 38363 FlyBaseID:FBgn0052485 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_001031598.1 Gene:AT4G08690 / 826436 AraportID:AT4G08690 Length:301 Species:Arabidopsis thaliana


Alignment Length:202 Identity:52/202 - (25%)
Similarity:97/202 - (48%) Gaps:10/202 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 PINEQDFKDLKERMKLIVEADPK--QYHNDFSLRRYLRAFK-TTDDAFQAILKTNKWRETYGVDK 69
            |..|:..| ::|..||:.....|  .:.:|.::.|||||.. ....|.:.:.:|.|||..|..::
plant    15 PTEEEQAK-IEEVRKLLGPLPEKLSSFCSDDAVLRYLRARNWHVKKATKMLKETLKWRVQYKPEE 78

  Fly    70 LSEMDRSQLDKKARLLRHR--DCIGRPVIYI-PAKNHSSERDIDELTRFIVYNLEEACKKCFEEV 131
            :...:.:...:..::.|..  |.:||||:.: |:..:|  :.:....|::||.:|.|.:. ....
plant    79 ICWEEVAGEAETGKIYRSSCVDKLGRPVLIMRPSVENS--KSVKGQIRYLVYCMENAVQN-LPPG 140

  Fly   132 TDRLCIVFDLAEFSTSCMDYQLVQNLIWLLGKHFPERLGVCLIINSPGLFSTIWPAIRVLLDDNT 196
            .:::..:.|...:|.:.:..:..:....:|.:|:||||...::.|.|..|...|...|..|:..|
plant   141 EEQMVWMIDFHGYSLANVSLRTTKETAHVLQEHYPERLAFAVLYNPPKFFEPFWKVARPFLEPKT 205

  Fly   197 AKKVKFV 203
            ..|||||
plant   206 RNKVKFV 212

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32485NP_728794.1 CRAL_TRIO 85..219 CDD:279044 33/122 (27%)
AT4G08690NP_001031598.1 CRAL_TRIO_N 20..67 CDD:215024 12/47 (26%)
SEC14 87..241 CDD:214706 33/129 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45824
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.