DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32485 and AT3G24840

DIOPT Version :9

Sequence 1:NP_728794.1 Gene:CG32485 / 38363 FlyBaseID:FBgn0052485 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_001327840.1 Gene:AT3G24840 / 822082 AraportID:AT3G24840 Length:580 Species:Arabidopsis thaliana


Alignment Length:260 Identity:62/260 - (23%)
Similarity:114/260 - (43%) Gaps:55/260 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 SEELAPINEQDFKDLKER------MKLIVEAD---PKQYHNDF-SLRRYLRA----FKTTDDAFQ 53
            :::.|||..:|.:|.:|.      .|.:|..|   |:  |:|: ::.|:|:|    .:.|...::
plant    61 ADQYAPIVIEDVRDEEEEKAVNVFRKALVSLDLLPPR--HDDYHTMLRFLKARRFDLEKTVQMWE 123

  Fly    54 AILKTNKWRETYGVDK-LSEMDRSQLDKKARLLRHR----DCIGRPVIYI-------PAKNHSSE 106
            .:|   |||:..|||. :.:....:.::..:...|.    |..|||| ||       |.|    .
plant   124 EML---KWRKENGVDTIIQDFVYDEYEEVQQYYPHGYHGVDREGRPV-YIERLGKIDPGK----L 180

  Fly   107 RDIDELTRFIVYNLE----------EACKKCFEEVTDRLCIVFDLAEFSTSCMDY-QLVQNLIWL 160
            ..:..|.||:.|:::          .||....:...:....:.|:  ...|.|.: :|.|:|:..
plant   181 MKVTTLERFLRYHVQGFEKTFSEKFPACSIAAKRHINSSTTIIDV--HGVSWMSFRKLAQDLVMR 243

  Fly   161 L----GKHFPERLGVCLIINSPGLFSTIWPAIRVLLDDNTAKKVKFVADE--AELCQYLIPDILP 219
            :    |.::||.|....|||:...|..:|..::..||..|..|:..:.::  :.|.:.:.|..||
plant   244 MQKIDGDNYPETLNQMYIINAGNGFKLVWNTVKGFLDPKTTSKIHVLGNKYRSHLLEIIDPSELP 308

  Fly   220  219
            plant   309  308

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32485NP_728794.1 CRAL_TRIO 85..219 CDD:279044 37/161 (23%)
AT3G24840NP_001327840.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1133487at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.