DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32485 and AT2G21520

DIOPT Version :9

Sequence 1:NP_728794.1 Gene:CG32485 / 38363 FlyBaseID:FBgn0052485 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_001118356.1 Gene:AT2G21520 / 816691 AraportID:AT2G21520 Length:637 Species:Arabidopsis thaliana


Alignment Length:259 Identity:62/259 - (23%)
Similarity:115/259 - (44%) Gaps:54/259 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 SSEELAPINEQDFKDLKE-------RMKLIVEADPKQYHNDFSLR-RYLRAFK-TTDDAFQAILK 57
            |...::.::.:|.:|::|       |..|:::......|:|:.:. |:|:|.| ..:.|.|....
plant    71 SDGRVSSVSIEDVRDVEELQAVDAFRQSLLMDELLPDRHDDYHMMLRFLKARKFDVEKAKQMWAD 135

  Fly    58 TNKWRETYGVDK-LSEMDRSQLDKKARLLRHR-------DCIGRPVIYIPAKNHSSERDIDELT- 113
            ..:||:.:|.|. :.:.|..::::   :|:|.       |..||| |||..........:.::| 
plant   136 MIQWRKEFGTDTIIQDFDFEEINE---VLKHYPQCYHGVDKEGRP-IYIERLGKVDPNRLMQVTS 196

  Fly   114 --RFIVYNLEE----------ACKKCFEEVTDRLCIVFD-----LAEFSTSCMDYQLVQNLIWLL 161
              |::.|:::|          :|....:...|....:.|     |..|:.|..|  |:..|..:.
plant   197 MDRYVRYHVKEFERSFMIKFPSCTISAKRHIDSSTTILDVQGVGLKNFNKSARD--LITRLQKID 259

  Fly   162 GKHFPERLGVCLIINS-PGLFSTIWPAIRVLLDDNTAKKV-----KF------VADEAELCQYL 213
            |.::||.|....|||: || |..:|..::..||..|:.|:     |:      |.|..||.::|
plant   260 GDNYPETLHQMFIINAGPG-FRLLWNTVKSFLDPKTSAKIHVLGYKYLSKLLEVIDVNELPEFL 322

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32485NP_728794.1 CRAL_TRIO 85..219 CDD:279044 43/166 (26%)
AT2G21520NP_001118356.1 CRAL_TRIO_N 90..136 CDD:215024 10/45 (22%)
SEC14 154..324 CDD:238099 43/176 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1133487at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.