DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32485 and Sec14l1

DIOPT Version :9

Sequence 1:NP_728794.1 Gene:CG32485 / 38363 FlyBaseID:FBgn0052485 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_083053.2 Gene:Sec14l1 / 74136 MGIID:1921386 Length:719 Species:Mus musculus


Alignment Length:240 Identity:55/240 - (22%)
Similarity:105/240 - (43%) Gaps:30/240 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 ELAPINEQDFKDLKERMKLIVEADPKQYHNDFSLRRYLRAFK-TTDDAFQAILKTNKWRETYGVD 68
            :|.|:.|.....|::.::   |....:...|..:.|:|||.. ..|.|.:.:.::..||:.:.||
Mouse   250 DLTPLQESCLIRLRQWLQ---ETHKGKIPKDEHILRFLRARDFNIDKAREIMCQSLTWRKQHQVD 311

  Fly    69 KLSEM---DRSQLDKKARLLRHRDCIGRPVIYIPAKNHSSERDI------DELTRFIVYNLEEAC 124
            .:.:.   .:..||..|....|.|..||| :|:........:.:      :.|.|:::...||..
Mouse   312 YILDTWTPPQVLLDYYAGGWHHHDKDGRP-LYVLRLGQMDTKGLVRALGEEALLRYVLSINEEGL 375

  Fly   125 KKCFEE-------VTDRLCIVFDLAEFSTSCM---DYQLVQNLIWLLGKHFPERLGVCLIINSPG 179
            ::|.|.       ::...|:| ||...:...:   ..:.:..:|.::..::||.||..||:.:|.
Mouse   376 RRCEENTKVFGRPISSWTCLV-DLEGLNMRHLWRPGVKALLRIIEVVEANYPETLGRLLILRAPR 439

  Fly   180 LFSTIWPAIRVLLDDNTAKKVKFVADE-----AELCQYLIPDILP 219
            :|..:|..:...:||||.:|....|..     ..|..|:..:|:|
Mouse   440 VFPVLWTLVSPFIDDNTRRKFLIYAGNDYQGPGGLLDYIDKEIIP 484

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32485NP_728794.1 CRAL_TRIO 85..219 CDD:279044 35/154 (23%)
Sec14l1NP_083053.2 Required for interaction and inhibitory function toward DDX58. /evidence=ECO:0000250|UniProtKB:Q92503 1..510 55/240 (23%)
PRELI 17..173 CDD:282550
CRAL_TRIO_N 256..301 CDD:215024 10/47 (21%)
CRAL_TRIO 326..490 CDD:279044 37/161 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1133487at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.