DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32485 and Sec14l3

DIOPT Version :9

Sequence 1:NP_728794.1 Gene:CG32485 / 38363 FlyBaseID:FBgn0052485 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_072130.1 Gene:Sec14l3 / 64543 RGDID:620812 Length:400 Species:Rattus norvegicus


Alignment Length:251 Identity:51/251 - (20%)
Similarity:103/251 - (41%) Gaps:55/251 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 ELAPINEQDFKDLKERMKLIVEADPKQYHNDFSLRRYLRAFKTTDDAFQAIL-KTNKWRETYGVD 68
            :|:|...:.....:|.::.::.|.|..  :|:.|.|:|||........:|:| |..::|:|..:|
  Rat     7 DLSPKQAETLAKFRENVQDVLPALPNP--DDYFLLRWLRARNFDLQKSEAMLRKYMEFRKTMDID 69

  Fly    69 KLSEMDRSQLDKKARLLRHRDCIGRPVIYIPAKNHSSERDIDELTRFIVYNLE------------ 121
            .:.:....::.:|               |:|......:||...|...|:..|:            
  Rat    70 HILDWQPPEVIQK---------------YMPGGLCGYDRDGCPLWYDIIGPLDPKGLLFSVTKQD 119

  Fly   122 ------EACKKCFEEV---TDRL-------CIVFD-----LAEFSTSCMDYQLVQNLIWLLGKHF 165
                  ..|::...|.   |:||       .::||     |..|....:  ::.|....||.:::
  Rat   120 LLKTKMRDCERILHECDLQTERLGRKIETIVMIFDCEGLGLKHFWKPLV--EVYQEFFGLLEENY 182

  Fly   166 PERLGVCLIINSPGLFSTIWPAIRVLLDDNTAKKVKFVAD--EAELCQYLIPDILP 219
            ||.|...||:.:..||...:..::..|.::|.:|:..:.:  :..|.:.:.|:.||
  Rat   183 PETLKFMLIVKATKLFPVGYNLMKPFLSEDTRRKIVVLGNSWKEGLLKLISPEELP 238

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32485NP_728794.1 CRAL_TRIO 85..219 CDD:279044 31/168 (18%)
Sec14l3NP_072130.1 CRAL_TRIO_N 13..59 CDD:215024 11/47 (23%)
SEC14 76..245 CDD:214706 34/180 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1133487at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.