DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32485 and RLBP1

DIOPT Version :9

Sequence 1:NP_728794.1 Gene:CG32485 / 38363 FlyBaseID:FBgn0052485 Length:222 Species:Drosophila melanogaster
Sequence 2:XP_016877949.1 Gene:RLBP1 / 6017 HGNCID:10024 Length:326 Species:Homo sapiens


Alignment Length:231 Identity:53/231 - (22%)
Similarity:95/231 - (41%) Gaps:29/231 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 SSEELAPINEQDFKDLKERMKLIVEADPKQYHNDFSLRRYLRAFK-TTDDAFQAILKTNKWRETY 65
            |.||||                :..|:..|..:.....|::||.| ....|::.:.....:|..|
Human    85 SGEELA----------------VAVAERVQEKDSGFFLRFIRARKFNVGRAYELLRGYVNFRLQY 133

  Fly    66 G--VDKLS-EMDRSQLDK-KARLLRHRDCIGRPVIYIPAKN-HSSERDIDELTRFIVYNLEEACK 125
            .  .|.|| |..|..::. ...:|..||..||.|:....:| .|.|...||:.:...:.||:..:
Human   134 PELFDSLSPEAVRCTIEAGYPGVLSSRDKYGRVVMLFNIENWQSQEITFDEILQAYCFILEKLLE 198

  Fly   126 KCFEEV-TDRLCIVFDLAEFS---TSCMDYQLVQNLIWLLGKHFPERLGVCLIINSPGLFSTIWP 186
            .  ||. .:..||:.:...|:   .:.:....::.::.:|...||.|......|:.|..|:|.:.
Human   199 N--EETQINGFCIIENFKGFTMQQAASLRTSDLRKMVDMLQDSFPARFKAIHFIHQPWYFTTTYN 261

  Fly   187 AIRVLLDDNTAKKVKFVADE-AELCQYLIPDILPTD 221
            .::..|.....::|....|: :...|.:..:|||:|
Human   262 VVKPFLKSKLLERVFVHGDDLSGFYQEIDENILPSD 297

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32485NP_728794.1 CRAL_TRIO 85..219 CDD:279044 31/139 (22%)
RLBP1XP_016877949.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165145918
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1133487at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.750

Return to query results.
Submit another query.