DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32485 and clvs2

DIOPT Version :9

Sequence 1:NP_728794.1 Gene:CG32485 / 38363 FlyBaseID:FBgn0052485 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_001020716.1 Gene:clvs2 / 566769 ZFINID:ZDB-GENE-041014-313 Length:329 Species:Danio rerio


Alignment Length:238 Identity:52/238 - (21%)
Similarity:99/238 - (41%) Gaps:36/238 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 ERMKLIVEADPKQYHNDFS---------------------LRRYLRAFKTTD-DAFQAILKTNKW 61
            |:.|:.::.:|...|.|..                     :.|:|||.|... :||:.:.:..::
Zfish    14 EKAKVELKENPDTLHQDIQEVRDMIITRPDIGFLRTDDAFILRFLRARKFNHFEAFRLLAQYFEY 78

  Fly    62 RETYGVDKLSEMDRSQLDKKARL-------LRHRDCIGRPVIYIPAKNHSSER-DIDELTRFIVY 118
            |: ..:|....:..:....|..|       |.:.|..||.::.:.|.|....| ...::.|.|:.
Zfish    79 RQ-QNLDMFKNLKATDPGIKQALKDGFPGVLSNLDRYGRKILVLFAANWDQSRYTFVDILRAILL 142

  Fly   119 NLEEACKKCFEEVTDRLCIVFDLAEFS---TSCMDYQLVQNLIWLLGKHFPERLGVCLIINSPGL 180
            :| ||..:..|...:...::.|.:.|:   .|.:...:::..|..|...||.|.|....:|.|..
Zfish   143 SL-EAMIEDPELQVNGFVLIIDWSNFTFKQASKLTPSMLRLAIEGLQDSFPARFGGIHFVNQPWY 206

  Fly   181 FSTIWPAIRVLLDDNTAKKVKFVADEA-ELCQYLIPDILPTDM 222
            ...::..||..|.|.|.|::....:.. .|.|.::|:|||:::
Zfish   207 IHALYTVIRPFLKDKTRKRIFMHGNNLNSLHQLILPEILPSEL 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32485NP_728794.1 CRAL_TRIO 85..219 CDD:279044 34/138 (25%)
clvs2NP_001020716.1 CRAL_TRIO_N 29..75 CDD:215024 8/45 (18%)
SEC14 106..251 CDD:238099 36/145 (25%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 293..329
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.