DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32485 and sec14l8

DIOPT Version :9

Sequence 1:NP_728794.1 Gene:CG32485 / 38363 FlyBaseID:FBgn0052485 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_001093463.1 Gene:sec14l8 / 558964 ZFINID:ZDB-GENE-060526-180 Length:395 Species:Danio rerio


Alignment Length:235 Identity:48/235 - (20%)
Similarity:96/235 - (40%) Gaps:48/235 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 KERMKLIVEADPKQYHNDFSLRRYLRAFKTTDDAFQAILK--------------TNKWRETYGVD 68
            :|:::.::...|.|  :|..|.|:|||........:|:|:              |.:|:....:|
Zfish    20 REKVQDVLPQCPSQ--SDHFLLRWLRARNFNLQKSEAMLRKHIEFRKHMKVDTITTEWQVPEVID 82

  Fly    69 KLSEMDRSQLDKKARLLRHRDCIGRPVIY-----IPAKN--HSSERDIDELTRFIVYNLEEACKK 126
            |.........|::          |.||.|     :..|.  ||:.:  .:|.:..|.:.|...|.
Zfish    83 KYLSGGMCGHDRE----------GSPVWYDVIGPLDPKGLMHSASK--QDLIKSKVRDCEILQKD 135

  Fly   127 CFEEVTDRL-------CIVFDLAEFSTSCMDYQLVQ---NLIWLLGKHFPERLGVCLIINSPGLF 181
            | :..::||       .:|:|........:....::   .::.:...::||.|....:|.:|.||
Zfish   136 C-DRQSERLGRNIESITMVYDCEGLGMKHLYKPAIETYGEVLTMFEDNYPEGLKRLFVIKAPKLF 199

  Fly   182 STIWPAIRVLLDDNTAKKVKFVAD--EAELCQYLIPDILP 219
            ...:..::..|.::|.:||..:..  :..|.:|:.|:.||
Zfish   200 PVAYNLVKHFLSEDTRRKVIVLGSNWQEVLQKYIDPEELP 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32485NP_728794.1 CRAL_TRIO 85..219 CDD:279044 30/152 (20%)
sec14l8NP_001093463.1 CRAL_TRIO_N 13..59 CDD:215024 11/40 (28%)
SEC14 78..246 CDD:214706 35/175 (20%)
GOLD_2 304..382 CDD:290608
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1133487at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.