DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32485 and Ttpa

DIOPT Version :9

Sequence 1:NP_728794.1 Gene:CG32485 / 38363 FlyBaseID:FBgn0052485 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_056582.1 Gene:Ttpa / 50500 MGIID:1354168 Length:278 Species:Mus musculus


Alignment Length:243 Identity:51/243 - (20%)
Similarity:94/243 - (38%) Gaps:47/243 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 APINEQDFKDLKERMKLIVEADPKQYHNDFSLRRYLRAFK-TTDDAFQAILKTNKWRETYGVDKL 70
            :|:.:....:|:.|::........|...|..|.|:|||.. ..|.|::.:....|||        
Mouse    21 SPLLQPGLAELRRRVQEAGVPQTPQPLTDAFLLRFLRARDFDLDLAWRLMKNYYKWR-------- 77

  Fly    71 SEMDRSQLDKKARLLRHRDCIGRPVIYIPAKNHSSERDIDEL-TRFIVYNLEEACKKCFEE---- 130
            :|......|     ||.|..:|    .:.|..|...|..|.. :|.::|.:.....|.|..    
Mouse    78 AECPELSAD-----LRPRSILG----LLKAGYHGVLRSRDSTGSRVLIYRIAYWDPKVFTAYDVF 133

  Fly   131 ----VTDRLCI------------VFDLAEFSTSCMDYQL----VQNLIWLLGKHFPERLGVCLII 175
                :|..|.:            :|||..:..| ..:|:    .:.:..:|...||.::....:|
Mouse   134 RVSLITSELIVQEVETQRNGVKAIFDLEGWQVS-HAFQITPSVAKKIAAVLTDSFPLKVRGIHLI 197

  Fly   176 NSPGLFSTIWPAIRVLLDDNTAKKVKFVAD--EAELCQYLIPDILPTD 221
            |.|.:|..::..|:..|.:....::....:  ::.:.|: .|||||.:
Mouse   198 NEPVIFHAVFSMIKPFLTEKIKDRIHLHGNNYKSSMLQH-FPDILPRE 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32485NP_728794.1 CRAL_TRIO 85..219 CDD:279044 32/160 (20%)
TtpaNP_056582.1 CRAL_TRIO_N 25..73 CDD:215024 11/47 (23%)
CRAL_TRIO 99..248 CDD:279044 29/148 (20%)
Phosphatidylinositol 3,4-bisphosphate binding. /evidence=ECO:0000269|PubMed:23599266, ECO:0007744|PDB:3W67 190..192 0/1 (0%)
Phosphatidylinositol 4,5-bisphosphate binding. /evidence=ECO:0000269|PubMed:23599266, ECO:0007744|PDB:3W68 208..211 0/2 (0%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.