DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32485 and mospd2

DIOPT Version :9

Sequence 1:NP_728794.1 Gene:CG32485 / 38363 FlyBaseID:FBgn0052485 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_001008142.1 Gene:mospd2 / 493504 XenbaseID:XB-GENE-957659 Length:509 Species:Xenopus tropicalis


Alignment Length:213 Identity:43/213 - (20%)
Similarity:96/213 - (45%) Gaps:17/213 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 DFKDLKERMKLIVEADPKQYHNDFSLRRYLRAFKTTDDAFQAILKTNKWRETYGVDKLSE--MDR 75
            |.:|::...|     |.....:....|.|:     |::|.:.:.::.|||:..||:.|:|  :.:
 Frog    29 DSRDVERLQK-----DDTLVESYLMWRHYV-----TEEALKMMDESLKWRKDIGVNDLNESTIPK 83

  Fly    76 SQLDKKARLLRHRDCIGRPVIYIPAKNHSSE-RDIDELTRFIVYNLEEACKKCFEEVTDRLCIVF 139
            ...:..|..|...|..|..::::..|.|..: :..::..:|:.:.||...::   |....:.:||
 Frog    84 WCFETGASYLHGYDKEGNKLLWLKVKLHVRDGKTTEDKKKFVAFWLERYARR---EPGKFITVVF 145

  Fly   140 DLAEFSTSCMDYQLVQNLIWLLGKHFPERLGVCLIINSPGLFSTIWPAIRVLLDDNTAKKVKFVA 204
            |:.:...|.:|...|:.::.....::|..|...:|...|.:.:..:..::..|.......:|| |
 Frog   146 DMVDSGLSNVDMDFVRFVVNSFKTYYPRYLSKMVIYEMPWILNAAFKIVKSWLGPEAISLLKF-A 209

  Fly   205 DEAELCQYLIPDILPTDM 222
            ::.::..|:..:.||..|
 Frog   210 NKNQVQDYISAEYLPPHM 227

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32485NP_728794.1 CRAL_TRIO 85..219 CDD:279044 24/134 (18%)
mospd2NP_001008142.1 CRAL_TRIO 88..230 CDD:366224 28/144 (19%)
Motile_Sperm 315..419 CDD:334183
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002427
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1928
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.