DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32485 and rlbp1

DIOPT Version :9

Sequence 1:NP_728794.1 Gene:CG32485 / 38363 FlyBaseID:FBgn0052485 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_001005455.1 Gene:rlbp1 / 448050 XenbaseID:XB-GENE-976303 Length:317 Species:Xenopus tropicalis


Alignment Length:260 Identity:56/260 - (21%)
Similarity:99/260 - (38%) Gaps:59/260 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 SSEELAPINEQDFKDLKERMKLIVE------------ADP-KQYHNDFSLRRYLRAFK-TTDDAF 52
            :.:||....|:....:||...|:.|            ||. |...:||.| |::||.| ....|:
 Frog    48 AKDELNETEEKRESAVKELRALVQEKANAGEELCKAVADKVKDKGDDFFL-RFIRARKFDVSRAY 111

  Fly    53 QAILKTNKWRETYG---VDKLSEMDRSQLDK-KARLLRHRDCIGRPVIYIPAKNHSSERDIDELT 113
            :.:.....:|:.|.   .|...|..||.::. ...:|..||..||.::....::.    |.:|:|
 Frog   112 ELLKGYVNFRQQYPELFEDLTPEAVRSTIEAGYPGILTSRDKNGRVILLFNIESW----DYEEIT 172

  Fly   114 RFIVYNLEEACKKCFEEVTDRLCIVFD--LAEFSTSCMDYQLVQN-------------------L 157
                          |:|:....||:.:  |....|....:.:::|                   :
 Frog   173 --------------FDEILRAYCIILESLLENEETQINGFCIIENFKGFTMQQASGIKPSELKKM 223

  Fly   158 IWLLGKHFPERLGVCLIINSPGLFSTIWPAIRVLLDDNTAKKVKFVADEAE-LCQYLIPDILPTD 221
            :.:|...||.|......|:.|..|:|.:..::..|.....::|....|:.| ..:.:..||||.|
 Frog   224 VDMLQDSFPARFKAVHFIHQPWYFTTTYNVVKPFLKSKLLERVFVHGDDLEGFYKEIDADILPAD 288

  Fly   222  221
             Frog   289  288

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32485NP_728794.1 CRAL_TRIO 85..219 CDD:279044 29/155 (19%)
rlbp1NP_001005455.1 CRAL_TRIO_N 60..117 CDD:215024 15/57 (26%)
CRAL_TRIO 143..292 CDD:306996 32/164 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1133487at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.