DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32485 and CG10300

DIOPT Version :9

Sequence 1:NP_728794.1 Gene:CG32485 / 38363 FlyBaseID:FBgn0052485 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_651174.2 Gene:CG10300 / 42798 FlyBaseID:FBgn0039107 Length:311 Species:Drosophila melanogaster


Alignment Length:235 Identity:49/235 - (20%)
Similarity:77/235 - (32%) Gaps:59/235 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 APINEQDFKDLKERMKLIVEADPKQYHNDFSLRRYLRAFKTTDDAFQAILKTNKWRETYGVDKLS 71
            ||.:||.......|.:...|...:::.|.:|||                   :.:.|..|..::.
  Fly    46 APTDEQLILAFLRRCRFSQEETKRRFDNYYSLR-------------------SVFPEVLGSRQVD 91

  Fly    72 EMDRSQLDKKARLLRHRDCIGRPVIYIPAKNHSSE---------RDID-------ELTRFIVYNL 120
            |...:||.             |.:..||.:..|.|         |:||       |..:.|...|
  Fly    92 EALLTQLQ-------------RGIHVIPMRPVSPEGPRVIISQFRNIDPKKSNPREAFKLIFIML 143

  Fly   121 EEACKKCFEEVTDRLCIVFDLAEFSTSCMDYQLVQNLIWLLGKHF-------PERLGVCLIINSP 178
            |....:|.......|..|.|..:.:..    |::|...:||.|.|       |.|.....:||..
  Fly   144 ELLALECDNAAISGLIWVVDARDVTME----QMMQYDPFLLKKAFALVDQCIPLRFVEIHMINMR 204

  Fly   179 GLFSTIWPAIRVLLDDNTAKKVKFVADEAELCQYLIPDIL 218
            ....||:..:...|......|........:|.|:|..|::
  Fly   205 KEGQTIFNFVTKFLPSKLPFKFVVHKKSEDLYQHLPRDVM 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32485NP_728794.1 CRAL_TRIO 85..219 CDD:279044 34/157 (22%)
CG10300NP_651174.2 SEC14 95..251 CDD:238099 36/167 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45447117
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.