powered by:
Protein Alignment CG32485 and pinta
DIOPT Version :9
Sequence 1: | NP_728794.1 |
Gene: | CG32485 / 38363 |
FlyBaseID: | FBgn0052485 |
Length: | 222 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001287466.1 |
Gene: | pinta / 42635 |
FlyBaseID: | FBgn0038966 |
Length: | 273 |
Species: | Drosophila melanogaster |
Alignment Length: | 66 |
Identity: | 15/66 - (22%) |
Similarity: | 28/66 - (42%) |
Gaps: | 10/66 - (15%) |
- Green bases have known domain annotations that are detailed below.
Fly 16 DLKERMKLIVEA---DPKQYHNDFSLRRYLRAFKTTDDAFQAILKTNKWRETYGVDKLSEMDRSQ 77
|.::||.:::.. |||.:..: ..|||:......:||.:......|:..:.:|...|
Fly 105 DAEQRMVVVIRTAAHDPKLHSQN-------NVFKTSKMILDLLLKLDPETCARGMVAILDMQGVQ 162
Fly 78 L 78
|
Fly 163 L 163
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
CG32485 | NP_728794.1 |
CRAL_TRIO |
85..219 |
CDD:279044 |
|
pinta | NP_001287466.1 |
SEC14 |
87..240 |
CDD:238099 |
15/66 (23%) |
Blue background indicates that the domain is not in
the aligned region.
|
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG1471 |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.