Sequence 1: | NP_728794.1 | Gene: | CG32485 / 38363 | FlyBaseID: | FBgn0052485 | Length: | 222 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_648579.3 | Gene: | CG10657 / 39423 | FlyBaseID: | FBgn0036289 | Length: | 334 | Species: | Drosophila melanogaster |
Alignment Length: | 271 | Identity: | 56/271 - (20%) |
---|---|---|---|
Similarity: | 89/271 - (32%) | Gaps: | 97/271 - (35%) |
- Green bases have known domain annotations that are detailed below.
Fly 17 LKERMKLIVEADPKQYHNDFSLRR--------------YLRAFKTTDDAFQAILKTNKWRETYGV 67
Fly 68 DKLSEM-DR------------SQLD----------KKARL--LRHRDCIGRPVIYI--------- 98
Fly 99 -----PAKNHS-------SERDIDELTRFIVYNLEEACKKCFE---EVTDRLCIVFDLAEFSTSC 148
Fly 149 MDYQLVQNLIWLLGK--HFPERLGVCLIINSPGLFSTIWPAIRVLLDDNTAKKVKFVADEAELCQ 211
Fly 212 YLI-PDILPTD 221 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG32485 | NP_728794.1 | CRAL_TRIO | 85..219 | CDD:279044 | 33/160 (21%) |
CG10657 | NP_648579.3 | CRAL_TRIO_N | 52..98 | CDD:215024 | 8/49 (16%) |
CRAL_TRIO | 126..274 | CDD:279044 | 36/169 (21%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG1471 | |
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |