DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32485 and CG10657

DIOPT Version :9

Sequence 1:NP_728794.1 Gene:CG32485 / 38363 FlyBaseID:FBgn0052485 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_648579.3 Gene:CG10657 / 39423 FlyBaseID:FBgn0036289 Length:334 Species:Drosophila melanogaster


Alignment Length:271 Identity:56/271 - (20%)
Similarity:89/271 - (32%) Gaps:97/271 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 LKERMKLIVEADPKQYHNDFSLRR--------------YLRAFKTTDDAFQAILKTNKWRETYGV 67
            |...|||:.:   ::.|.|.::||              ::|..:|........|:|.|    :.|
  Fly    31 LSPAMKLVAK---EELHEDENIRRQALAQFREWIEKHPHIRKCRTDTVFLLRFLRTKK----FSV 88

  Fly    68 DKLSEM-DR------------SQLD----------KKARL--LRHRDCIGRPVIYI--------- 98
            ....|| :|            .|||          :...|  |..||..||.||:.         
  Fly    89 PSACEMLERYLTIRQLFPQWFKQLDINDPAINEIFENGYLVPLPQRDSTGRQVIFSVAAKFDPYK 153

  Fly    99 -----PAKNHS-------SERDIDELTRFIVYNLEEACKKCFE---EVTDRLCIVFDLAEFSTSC 148
                 .|:.||       .:.| .::..::..|.|......|.   .:||...||          
  Fly   154 FTSVQMARVHSLVCEALLDDED-SQVAGYVYINDESGMNMGFVSLWSLTDLRSIV---------- 207

  Fly   149 MDYQLVQNLIWLLGK--HFPERLGVCLIINSPGLFSTIWPAIRVLLDDNTAKKVKFVADEAELCQ 211
               :.:||...:..|  ||         :|.|...:.|......:|.|...|:: .|....::.:
  Fly   208 ---KCIQNSTPMRHKETHF---------VNIPHYANRIIELGVSMLSDKLKKRI-IVHKNVDILK 259

  Fly   212 YLI-PDILPTD 221
            ..| |.|||.:
  Fly   260 TKIDPAILPKE 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32485NP_728794.1 CRAL_TRIO 85..219 CDD:279044 33/160 (21%)
CG10657NP_648579.3 CRAL_TRIO_N 52..98 CDD:215024 8/49 (16%)
CRAL_TRIO 126..274 CDD:279044 36/169 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.