Sequence 1: | NP_728794.1 | Gene: | CG32485 / 38363 | FlyBaseID: | FBgn0052485 | Length: | 222 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_957392.1 | Gene: | sec14l1 / 394073 | ZFINID: | ZDB-GENE-040426-801 | Length: | 697 | Species: | Danio rerio |
Alignment Length: | 222 | Identity: | 56/222 - (25%) |
---|---|---|---|
Similarity: | 96/222 - (43%) | Gaps: | 35/222 - (15%) |
- Green bases have known domain annotations that are detailed below.
Fly 29 PKQYHNDFSLRRYLRAFK-TTDDAFQAILKTNKWRETYGVDKLSEMDRSQ---LDKKARLLRHRD 89
Fly 90 CIGRPVIYIPAKNHSSERDI------DELTRFIVYNLEEACKKCFEE-------VTDRLCIVFDL 141
Fly 142 AEFSTSCM---DYQLVQNLIWLLGKHFPERLGVCLIINSPGLFSTIWPAIRVLLDDNTAKKVKFV 203
Fly 204 ADE-----AELCQYL----IPDILPTD 221 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG32485 | NP_728794.1 | CRAL_TRIO | 85..219 | CDD:279044 | 39/158 (25%) |
sec14l1 | NP_957392.1 | PRELI | 17..173 | CDD:282550 | |
CRAL_TRIO_N | 238..283 | CDD:215024 | 8/29 (28%) | ||
CRAL_TRIO | 308..472 | CDD:279044 | 40/165 (24%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D1133487at2759 | |
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.920 |