DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32485 and sec14l1

DIOPT Version :9

Sequence 1:NP_728794.1 Gene:CG32485 / 38363 FlyBaseID:FBgn0052485 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_957392.1 Gene:sec14l1 / 394073 ZFINID:ZDB-GENE-040426-801 Length:697 Species:Danio rerio


Alignment Length:222 Identity:56/222 - (25%)
Similarity:96/222 - (43%) Gaps:35/222 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 PKQYHNDFSLRRYLRAFK-TTDDAFQAILKTNKWRETYGVDKLSEMDRSQ---LDKKARLLRHRD 89
            ||..|    :.|:||:.. ..:.|.:|:.:|..||:.:.:|.|.:..:|.   .|.......|.|
Zfish   257 PKDQH----VLRFLRSRDFNLEKAKEALCQTLTWRKQHQIDFLLDTWQSPQPLQDYYTGGWHHHD 317

  Fly    90 CIGRPVIYIPAKNHSSERDI------DELTRFIVYNLEEACKKCFEE-------VTDRLCIVFDL 141
            ..||| :||........:.:      :.|.|.::...||..::|.|.       ::...|:| ||
Zfish   318 KDGRP-LYILRLGQMDTKGLVRALGEETLLRHVLSINEEGLRRCEENTKIFGKPISCWTCLV-DL 380

  Fly   142 AEFSTSCM---DYQLVQNLIWLLGKHFPERLGVCLIINSPGLFSTIWPAIRVLLDDNTAKKVKFV 203
            ...:...:   ..:.:..:|.::|.::||.||..||:.:|.:|..:|..:...:|:||.||....
Zfish   381 EGLNMRHLWRPGIKALLRMIEVVGANYPETLGRLLILRAPRVFPVLWTLVSPFIDENTRKKFLIY 445

  Fly   204 ADE-----AELCQYL----IPDILPTD 221
            |..     ..|..|:    |||.|..|
Zfish   446 AGNDYQGPGGLVDYINKDCIPDFLGGD 472

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32485NP_728794.1 CRAL_TRIO 85..219 CDD:279044 39/158 (25%)
sec14l1NP_957392.1 PRELI 17..173 CDD:282550
CRAL_TRIO_N 238..283 CDD:215024 8/29 (28%)
CRAL_TRIO 308..472 CDD:279044 40/165 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1133487at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.