DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32485 and rlbp1a

DIOPT Version :9

Sequence 1:NP_728794.1 Gene:CG32485 / 38363 FlyBaseID:FBgn0052485 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_956999.1 Gene:rlbp1a / 393678 ZFINID:ZDB-GENE-040426-1662 Length:312 Species:Danio rerio


Alignment Length:261 Identity:57/261 - (21%)
Similarity:100/261 - (38%) Gaps:61/261 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 SSEELAPINEQDFKDLKERMKLIVE------------ADPKQYHNDFSLRRYLRAFKTTDDAFQA 54
            :.:||...:|:....:||...:|.:            .|......|..|.|::||.|........
Zfish    47 AKDELNETDEKRASAIKELRAMIKDKAGQGDEVAKTVQDKFGKEPDSLLLRFIRARKFDVARAHE 111

  Fly    55 ILKTN-KWRETYG--VDKLS-EMDRSQLDK-KARLLRHRDCIGRPVIYIPAKNHSSERDIDELTR 114
            ::|.. ::|..|.  .:.|: |..||.::. ..|:|..||..||.|:.....|.    |::|:| 
Zfish   112 LMKGYVRFRRDYPELFENLTPEAVRSTIEAGYPRILSTRDKNGRVVLLFNIDNW----DLEEVT- 171

  Fly   115 FIVYNLEEACKKCFEEVTDRLCIVFD--LAEFSTSCMDYQLVQN-------------------LI 158
                         |:|.....|::.:  |....|....:.|::|                   ::
Zfish   172 -------------FDETLRAYCVILEKLLENEETQINGFVLIENFKGFTMQHASGIKHTELKKMV 223

  Fly   159 WLLGKHFPERLGVCLIINSPGLFSTIWPAIRVLLDDNTAKKVKFVADEAELCQYLI---PDILPT 220
            .:|...||.|.....:|:.|..|:|.:..::..:.....::| ||..: ||..||.   .:|||.
Zfish   224 DMLQDSFPARFKAVHVIHQPWYFTTTYNVVKPFMKSKLLERV-FVHGD-ELDGYLRDFGAEILPP 286

  Fly   221 D 221
            |
Zfish   287 D 287

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32485NP_728794.1 CRAL_TRIO 85..219 CDD:279044 33/157 (21%)
rlbp1aNP_956999.1 CRAL_TRIO_N 59..116 CDD:215024 11/56 (20%)
CRAL_TRIO 142..291 CDD:279044 37/166 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1133487at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.