DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32485 and CG33966

DIOPT Version :9

Sequence 1:NP_728794.1 Gene:CG32485 / 38363 FlyBaseID:FBgn0052485 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_001033984.1 Gene:CG33966 / 3885642 FlyBaseID:FBgn0053966 Length:310 Species:Drosophila melanogaster


Alignment Length:215 Identity:47/215 - (21%)
Similarity:73/215 - (33%) Gaps:56/215 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 FSLRRYLRAFKTTDDAFQAILKTNKWRETY-----GVDKLSE---------MDRSQLDKKARLLR 86
            |||.|    .|:..|.|.. |:| |:.|.|     .|||..|         :.|...|...||  
  Fly    61 FSLER----TKSKIDRFYT-LRT-KYPEFYLGHNVDVDKALEIFRLGTIVILPRPLNDNGPRL-- 117

  Fly    87 HRDCIGRPVIYIPAKNHSSERDIDELTRFIVYNLEEACKKC-------FEE----VTDRLCIVFD 140
               .:.|...|.|:|                |.|:|..:..       .:|    :.:.|..:.|
  Fly   118 ---ALLRMACYDPSK----------------YTLQEVNRAAGLMQQIMLDEDDVAIVNGLISILD 163

  Fly   141 LAEFSTS---CMDYQLVQNLIWLLGKHFPERLGVCLIINSPGLFSTIWPAIRVLLDDNTAKKVKF 202
            |:..:|.   .|.....:.:.....:..|.|......||:|..|.||:..|:.::......::..
  Fly   164 LSNVTTGHFLQMSPSFAKKMTVFQEEALPLRPQGIHFINTPNGFDTIFNMIKPMMSKKQQGRLYV 228

  Fly   203 VADEAELCQYLIP-DILPTD 221
            ...:.|.....|| ..||.:
  Fly   229 HGSKWEALYNQIPKQYLPVE 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32485NP_728794.1 CRAL_TRIO 85..219 CDD:279044 25/148 (17%)
CG33966NP_001033984.1 CRAL_TRIO_N 30..72 CDD:215024 5/14 (36%)
SEC14 96..252 CDD:238099 32/174 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45447122
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.