DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32485 and CG33523

DIOPT Version :9

Sequence 1:NP_728794.1 Gene:CG32485 / 38363 FlyBaseID:FBgn0052485 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_001261457.1 Gene:CG33523 / 38668 FlyBaseID:FBgn0053523 Length:654 Species:Drosophila melanogaster


Alignment Length:227 Identity:50/227 - (22%)
Similarity:110/227 - (48%) Gaps:21/227 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 EELAPINEQDFKDLKERMKLIVEADP--KQYH--------ND-FSLRRYLRAFK-TTDDAFQAIL 56
            :|..|   |..::|::|......:.|  ..:|        || ..|:|:|..:. ..:.:|.::.
  Fly     6 KETTP---QQIEELRDRFNRKYASSPPAAPFHPTDIDRIRNDHLWLQRFLEMYDLDMETSFNSLW 67

  Fly    57 KTNKWRETYGVDKL--SEMDRSQLDKKARLLRHRDCIGRPVIYIPAKNHSSERDIDELTRFIVYN 119
            :|...|::.|.:.:  ||:::..|.:.:..:.:.|..|:|::....|.||..:::|||.|.:||.
  Fly    68 ETCILRQSTGANDIDESELNQEYLKEGSVFVHNTDVDGKPLLVFRVKMHSKSKNLDELIRIVVYW 132

  Fly   120 LEEACKKCFEEVTDRLCIVFDLAEFSTSCMDYQLVQNLIWLLGKHFPERLGVCLIINSPGLFSTI 184
            :|...:   |:...:|.|.||::..|.:.||.:.|:.::....:.:|..|...|:.....:.:..
  Fly   133 VERTQR---EQHLTQLTIFFDMSGTSLASMDLEFVKRIVETFKQFYPNSLNYILVYELGWVLNAA 194

  Fly   185 WPAIRVLLDDNTAKKVKFVADEAELCQYLIPD 216
            :..|:.:|.....:.:|.:: :.::.||:..|
  Fly   195 FKVIKAVLPPKAVEILKMIS-KKDINQYINKD 225

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32485NP_728794.1 CRAL_TRIO 85..219 CDD:279044 31/132 (23%)
CG33523NP_001261457.1 CRAL_TRIO 94..234 CDD:279044 31/136 (23%)
Motile_Sperm 293..396 CDD:279029
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002427
OrthoInspector 1 1.000 - - otm47394
orthoMCL 1 0.900 - - OOG6_101230
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1928
SonicParanoid 00.000 Not matched by this tool.
65.740

Return to query results.
Submit another query.