DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32485 and Cralbp

DIOPT Version :9

Sequence 1:NP_728794.1 Gene:CG32485 / 38363 FlyBaseID:FBgn0052485 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_523939.1 Gene:Cralbp / 38651 FlyBaseID:FBgn0035636 Length:324 Species:Drosophila melanogaster


Alignment Length:214 Identity:51/214 - (23%)
Similarity:80/214 - (37%) Gaps:40/214 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 NDFSLRRYLRAFK-TTDDAFQAILKTNKWRETYGVDKLSEMDRSQLD-KKARL-----------L 85
            :|..|.|:|||.| :...|.|.:||....|.|:     ..|. :||| .:.||           :
  Fly    53 DDTFLLRFLRAKKFSVPMAEQTLLKYLNIRRTF-----PHMS-TQLDYLEPRLGDLIDQGYIFAV 111

  Fly    86 RHRDCIGRPVIYIPAK--NHSSERDIDEL-TRFIVYNLEEACKKCFEEVTDR----LCIVFDLAE 143
            ..||..||.|:.|.||  |.......|:. ..|:.|       :|..|..:.    |..|.|.|.
  Fly   112 PQRDKHGRRVVVINAKGLNPKIHTSCDQAKAHFLTY-------ECLMEDQETQITGLTHVGDFAG 169

  Fly   144 FSTSCM----DYQLVQNLIWLLGKH-FPERLGVCLIINSPGLFSTIWPAIRVLLDDNTAKKVKFV 203
            .:|:.:    ..:..:...|  |:. .|.|.....:||.|.....:...::..:......::...
  Fly   170 VTTAHVTNWNPTEFARIFKW--GEQSLPMRHKEIHLINVPSTLKWLIDFVKNRVSSKMKNRLIIY 232

  Fly   204 ADEAELCQYLIPDILPTDM 222
            ..|.||.:.:....||.:|
  Fly   233 GSEKELMKSVDQGCLPLEM 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32485NP_728794.1 CRAL_TRIO 85..219 CDD:279044 29/145 (20%)
CralbpNP_523939.1 CRAL_TRIO_N 31..78 CDD:215024 10/24 (42%)
SEC14 101..254 CDD:238099 32/160 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.