DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32485 and CG13893

DIOPT Version :9

Sequence 1:NP_728794.1 Gene:CG32485 / 38363 FlyBaseID:FBgn0052485 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_612042.3 Gene:CG13893 / 38074 FlyBaseID:FBgn0035146 Length:407 Species:Drosophila melanogaster


Alignment Length:212 Identity:55/212 - (25%)
Similarity:97/212 - (45%) Gaps:29/212 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 DLKERMKLIVEADPKQY-------HNDFSLRRYLRAFKTTDDAFQAILKTN-KWRETYGVDKLSE 72
            ::.|..:.|:|...||.       |:|:.|.|:|||.|...:|.:.:|:.: |.|..:.||.:.:
  Fly     7 EISEEQRAILEKFRKQMDDALVGTHDDYFLVRWLRARKWNLEAAEKMLRASLKTRAMWNVDNIEK 71

  Fly    73 MD--RSQLDKKARLLRHRDCIGRPVIYIPAKN-------HSSERDIDELTRFIVYNLEEACKKCF 128
            .|  ::..:.....|...|..|.||:..|..|       |...|  .|..:::|..||...|..:
  Fly    72 WDPPKALQEYLPYGLMGYDNEGSPVLVCPFANFDMWGMMHCVTR--FEFQKYLVLLLERFMKIAY 134

  Fly   129 EEV------TDRLCIVFDLAEFSTSCMDY----QLVQNLIWLLGKHFPERLGVCLIINSPGLFST 183
            ::.      ..:|.:.||:.:.:.....:    :.|.:.:.....:|||.|.:|.|||:|.|||.
  Fly   135 DQSQKHGWRARQLVVFFDMQDVNLKQYAWRPAAECVISTVKQYEANFPELLKMCYIINAPKLFSV 199

  Fly   184 IWPAIRVLLDDNTAKKV 200
            .:..::..||:||..|:
  Fly   200 AFNIVKKFLDENTTSKI 216

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32485NP_728794.1 CRAL_TRIO 85..219 CDD:279044 35/133 (26%)
CG13893NP_612042.3 CRAL_TRIO_N 16..57 CDD:215024 13/40 (33%)
SEC14 75..246 CDD:238099 35/144 (24%)
GOLD_2 303..381 CDD:290608
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1133487at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.