DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32485 and Mospd2

DIOPT Version :9

Sequence 1:NP_728794.1 Gene:CG32485 / 38363 FlyBaseID:FBgn0052485 Length:222 Species:Drosophila melanogaster
Sequence 2:XP_006256927.1 Gene:Mospd2 / 363463 RGDID:1563952 Length:518 Species:Rattus norvegicus


Alignment Length:236 Identity:51/236 - (21%)
Similarity:96/236 - (40%) Gaps:42/236 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 KERMKLIVEA----------------DPKQ----YHNDFSLRRYL--------RAFKTTDDAFQA 54
            :.:.|||.|.                ||:.    ..:|..:..||        ...|..|::|| 
  Rat     7 QNKAKLISETRRRFEAEYVTEKSEKYDPRDVERLQQDDNWVESYLHWRHNVVDETLKMLDESFQ- 70

  Fly    55 ILKTNKWRETYGVDKLSE--MDRSQLDKKARLLRHRDCIGRPVIYIPAKNH-SSERDIDELTRFI 116
                  ||:...|:.|||  :.|..|:.....|...|..|..:.:|..|.| ..::.|.:..:.|
  Rat    71 ------WRKELSVNDLSESSIPRWLLELGGIYLHGYDKEGNKLFWIRVKYHIKDQKTIMDKKKLI 129

  Fly   117 VYNLEEACKKCFEEVTDRLCIVFDLAEFSTSCMDYQLVQNLIWLLGKHFPERLGVCLIINSPGLF 181
            .:.||...|:   |....:.::||::|...:.:|...|:.:|.....::|:.|...:|.:.|.:.
  Rat   130 AFWLERYAKR---ENGKPITVMFDMSETGLNSIDMDFVRFIINCFKVYYPKYLSKIVIFDMPWIM 191

  Fly   182 STIWPAIRVLLDDNTAKKVKFVADEAELCQYLIPDILPTDM 222
            :..:..::..|.......:||.: :.|:.:|:..:.||..|
  Rat   192 NAAFKIVKSWLGPEAVSLLKFTS-KNEIQEYVSVEYLPPHM 231

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32485NP_728794.1 CRAL_TRIO 85..219 CDD:279044 27/134 (20%)
Mospd2XP_006256927.1 CRAL_TRIO 93..234 CDD:279044 30/143 (21%)
Motile_Sperm 327..431 CDD:279029
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002427
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_101230
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.