DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32485 and Sec14l1

DIOPT Version :9

Sequence 1:NP_728794.1 Gene:CG32485 / 38363 FlyBaseID:FBgn0052485 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_001101779.1 Gene:Sec14l1 / 360668 RGDID:1563123 Length:720 Species:Rattus norvegicus


Alignment Length:240 Identity:54/240 - (22%)
Similarity:104/240 - (43%) Gaps:30/240 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 ELAPINEQDFKDLKERMKLIVEADPKQYHNDFSLRRYLRAFK-TTDDAFQAILKTNKWRETYGVD 68
            :|.|:.|.....|::.::   |....:...|..:.|:|||.. ..|.|.:.:.::..||:.:.||
  Rat   251 DLTPLQESCLIRLRQWLQ---ETHKGKIPKDEHILRFLRARDFNIDKAREIMCQSLTWRKQHQVD 312

  Fly    69 KLSEM---DRSQLDKKARLLRHRDCIGRPVIYIPAKNHSSERDI------DELTRFIVYNLEEAC 124
            .:.:.   .:...|..|....|.|..||| :|:........:.:      :.|.|:::...||..
  Rat   313 YILDTWTPPQVLQDYYAGGWHHHDKDGRP-LYVLRLGQMDTKGLVRALGEEALLRYVLSINEEGL 376

  Fly   125 KKCFEE-------VTDRLCIVFDLAEFSTSCM---DYQLVQNLIWLLGKHFPERLGVCLIINSPG 179
            ::|.|.       ::...|:| ||...:...:   ..:.:..:|.::..::||.||..||:.:|.
  Rat   377 RRCEENTKVFGRPISSWTCLV-DLEGLNMRHLWRPGVKALLRIIEVVEANYPETLGRLLILRAPR 440

  Fly   180 LFSTIWPAIRVLLDDNTAKKVKFVADE-----AELCQYLIPDILP 219
            :|..:|..:...:||||.:|....|..     ..|..|:..:|:|
  Rat   441 VFPVLWTLVSPFIDDNTRRKFLIYAGNDYQGPGGLLDYIDKEIIP 485

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32485NP_728794.1 CRAL_TRIO 85..219 CDD:279044 35/154 (23%)
Sec14l1NP_001101779.1 PRELI 17..173 CDD:282550
CRAL_TRIO_N 257..302 CDD:215024 10/47 (21%)
CRAL_TRIO 327..491 CDD:279044 37/161 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1133487at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.