powered by:
Protein Alignment CG32485 and CG12926
DIOPT Version :9
Sequence 1: | NP_728794.1 |
Gene: | CG32485 / 38363 |
FlyBaseID: | FBgn0052485 |
Length: | 222 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_610510.2 |
Gene: | CG12926 / 35996 |
FlyBaseID: | FBgn0033437 |
Length: | 313 |
Species: | Drosophila melanogaster |
Alignment Length: | 72 |
Identity: | 16/72 - (22%) |
Similarity: | 29/72 - (40%) |
Gaps: | 0/72 - (0%) |
- Green bases have known domain annotations that are detailed below.
Fly 150 DYQLVQNLIWLLGKHFPERLGVCLIINSPGLFSTIWPAIRVLLDDNTAKKVKFVADEAELCQYLI 214
|..||:.|..|..|.:|.|......:|:|..........:.|:.:...|:....:....|.:|:.
Fly 180 DAVLVKKLAVLGDKAYPYRPKGFHFVNAPSSAEKFMSIAKSLMSEKIRKRFHIHSKLDSLYKYVP 244
Fly 215 PDILPTD 221
.:.||.:
Fly 245 KECLPAE 251
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
1 |
0.930 |
- |
- |
|
C45447120 |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG1471 |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
|
2 | 1.830 |
|
Return to query results.
Submit another query.