DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32485 and CG12926

DIOPT Version :9

Sequence 1:NP_728794.1 Gene:CG32485 / 38363 FlyBaseID:FBgn0052485 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_610510.2 Gene:CG12926 / 35996 FlyBaseID:FBgn0033437 Length:313 Species:Drosophila melanogaster


Alignment Length:72 Identity:16/72 - (22%)
Similarity:29/72 - (40%) Gaps:0/72 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   150 DYQLVQNLIWLLGKHFPERLGVCLIINSPGLFSTIWPAIRVLLDDNTAKKVKFVADEAELCQYLI 214
            |..||:.|..|..|.:|.|......:|:|..........:.|:.:...|:....:....|.:|:.
  Fly   180 DAVLVKKLAVLGDKAYPYRPKGFHFVNAPSSAEKFMSIAKSLMSEKIRKRFHIHSKLDSLYKYVP 244

  Fly   215 PDILPTD 221
            .:.||.:
  Fly   245 KECLPAE 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32485NP_728794.1 CRAL_TRIO 85..219 CDD:279044 14/68 (21%)
CG12926NP_610510.2 CRAL_TRIO_N 32..77 CDD:215024
SEC14 117..254 CDD:238099 16/72 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45447120
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.