DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32485 and C11H1.9

DIOPT Version :9

Sequence 1:NP_728794.1 Gene:CG32485 / 38363 FlyBaseID:FBgn0052485 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_001024391.1 Gene:C11H1.9 / 3564775 WormBaseID:WBGene00023500 Length:421 Species:Caenorhabditis elegans


Alignment Length:147 Identity:33/147 - (22%)
Similarity:59/147 - (40%) Gaps:27/147 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 RMKLIVEADPKQYHNDFSLRRYLRAFKTT-----DDAFQAILKTN---KWRETYGVD--KLSEMD 74
            |:|:.....| .::.||::.|::.|.:.|     |....|.|..|   ::|:...:|  .:...|
 Worm    23 RLKIGQPIHP-NFNTDFNVYRFIMAAERTHKKERDVIKHAALALNNHLRYRKALNLDVEHIPSFD 86

  Fly    75 -----RSQLDKKARLLRHRDCIGRPVIYIPAKNHSSERDIDELTRFIVYNL--EEACKKCFEEVT 132
                 :.:|..:..:|...|...|.:.||.....:.|.        |.:::  .||||..|.:..
 Worm    87 GNPIFQKRLMPRGEILEKTDNQNRLLWYIEYATITVES--------IAHSIRSSEACKFQFLQFE 143

  Fly   133 DRLCIVFDLAEFSTSCM 149
            ..|..|.:..| .|.|:
 Worm   144 YMLRKVMEQEE-RTGCL 159

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32485NP_728794.1 CRAL_TRIO 85..219 CDD:279044 17/67 (25%)
C11H1.9NP_001024391.1 SEC14 88..261 CDD:214706 18/81 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.