DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32485 and CG10237

DIOPT Version :9

Sequence 1:NP_728794.1 Gene:CG32485 / 38363 FlyBaseID:FBgn0052485 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_609967.1 Gene:CG10237 / 35222 FlyBaseID:FBgn0032783 Length:324 Species:Drosophila melanogaster


Alignment Length:238 Identity:53/238 - (22%)
Similarity:99/238 - (41%) Gaps:32/238 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 EELAPINEQDFKDLKERMKLI-VEAD---PKQYHNDFSLRRYLRAFKTTDDAFQAILKTNKWRET 64
            :||....|:..:..||..:|: .|.|   ||  .|:..|.||||..|...::.:.::|.....:.
  Fly    58 KELRETPERQKEASKELARLLEAETDLLYPK--GNEEWLIRYLRPCKYYPESARDLIKRYYAFKV 120

  Fly    65 YGVDKLSEMDRSQLDKKARLLRH--------RDCIGRPVIYIPAKNHSSERDI--DELTRFIVYN 119
            ...|..:::..|   .:|.:.:|        ||.:||.::.:........:.:  ||:.:..|..
  Fly   121 KHADVYTDLKPS---NEANIFKHNILTVFPNRDQLGRRILVLELGKRWKHKQVTLDEVFKGAVLF 182

  Fly   120 LEEACKKCFEEVTDRLC---IVFDLAEFSTSCMDYQ----LVQNLIWLLGKHFPERLGVCLIINS 177
            ||.|    ..|...::|   ::||:...|.. ..:|    ..:.::..|....|.|:....|:|.
  Fly   183 LEAA----MLEPETQICGAVVIFDMDGLSLQ-QTWQFTPPFAKRIVDWLQDSVPLRIKAIHIVNQ 242

  Fly   178 PGLFSTIWPAIRVLLDDNTAKKVKF-VADEAELCQYLIPDILP 219
            |.:|..::...:..|.:....::.| ..|...|.:|:.|..||
  Fly   243 PKIFQVVFALFKPFLKEKLRSRIIFHGTDRESLHKYMSPKCLP 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32485NP_728794.1 CRAL_TRIO 85..219 CDD:279044 30/151 (20%)
CG10237NP_609967.1 CRAL_TRIO_N 68..115 CDD:215024 15/48 (31%)
SEC14 137..290 CDD:238099 32/154 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45447135
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.