DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32485 and CG5958

DIOPT Version :9

Sequence 1:NP_728794.1 Gene:CG32485 / 38363 FlyBaseID:FBgn0052485 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_609119.2 Gene:CG5958 / 34022 FlyBaseID:FBgn0031913 Length:294 Species:Drosophila melanogaster


Alignment Length:241 Identity:51/241 - (21%)
Similarity:110/241 - (45%) Gaps:31/241 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 ELAPINEQDFKDLKE----RMKLIVEADPK-QYHNDFS-LRRYLRAFK-TTDDAFQAILKTNKWR 62
            |:|.:..::.:::|.    :::.:::|.|: .|.:|.: |..:|||.. ..:.|.:.:..|..:|
  Fly    24 EIARVELRETEEVKAEAIIKLRELLKATPELNYKDDDAFLTVFLRACHFYPEGALEKMKTTASFR 88

  Fly    63 ETY-----GVDKLSEMDRSQLDKKA--RLLRHRDCIGRPVIYIPAKNHSSERDI--DELTR--FI 116
            :.|     |:  |.|..:.:..|.:  .:|::.|..||.|:.:.........||  ||:.|  ::
  Fly    89 KEYASLVRGL--LVEQVKEKFVKGSVINVLKNCDQKGRRVLIVNCGKLWDPSDITSDEMFRMLYM 151

  Fly   117 VY---NLEEACKKCFEEVTDRLCIV-FD-LAEFSTSCMDYQLVQNLIWLLGKHFPERLGVCLIIN 176
            |:   .|||.     .:|...:||: |: |:......:.....:.|:..:.:..|.|:.....:.
  Fly   152 VHLAAQLEEE-----TQVRGVVCIMDFEGLSMKQVKALSPSFSKRLLTFIQEAMPLRMKEVHFVK 211

  Fly   177 SPGLFSTIWPAIRVLLDDNTAKKVKF-VADEAELCQYLIPDILPTD 221
            .|.:|:.:|...:..:......::.| .:|...|.::|.|.:||.:
  Fly   212 QPFIFNMVWSLFKPFVKQKLNNRMHFHGSDMKSLQKFLDPSVLPAN 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32485NP_728794.1 CRAL_TRIO 85..219 CDD:279044 30/143 (21%)
CG5958NP_609119.2 CRAL_TRIO_N 38..82 CDD:215024 9/43 (21%)
CRAL_TRIO 111..261 CDD:279044 32/152 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.