DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32485 and CG33514

DIOPT Version :9

Sequence 1:NP_728794.1 Gene:CG32485 / 38363 FlyBaseID:FBgn0052485 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_001014558.1 Gene:CG33514 / 3346239 FlyBaseID:FBgn0053514 Length:311 Species:Drosophila melanogaster


Alignment Length:230 Identity:53/230 - (23%)
Similarity:87/230 - (37%) Gaps:65/230 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 SEELAPINEQDFKDLKERMKLIVEADPKQYHNDFSLRRYLRAFKT-----------TDDAF-QAI 55
            |.::.|:..:..|..||::|    .||::...|      |:||||           .||.| .|.
  Fly     2 SPQIRPLTPELQKVAKEQLK----EDPERLEAD------LQAFKTWIEQQPHLNPRMDDQFLVAF 56

  Fly    56 LKTNKWRETYGVDKLSEMDRSQLDKKARL-LRHRDCIGRPVIYIPAKN--HSSERDIDELTRFIV 117
            |:..|    |.:::.    :|:|||...| .::.|       |....|  .|..|:|.: |..|:
  Fly    57 LRGCK----YSLERA----KSKLDKYYTLKTKYPD-------YFRVTNTTDSKFREIHQ-TGAII 105

  Fly   118 YNLEEACKKCFEEVTDRLCI----VFDLAEFS-TSCMDYQLVQNLIWLLGKHFPERLGVCLIINS 177
            |     ......|...|:.|    :..:.::: ..||........|.:|...:....||..|::.
  Fly   106 Y-----LPTPLNENGPRIGIWRMGLVPVEKYTMLECMQVAQAMQEIAILEDDYANVNGVVFIMDM 165

  Fly   178 PG-----LFSTIWPAIRVLLDDNTAKKVKFVADEA 207
            .|     ||.         :..:.|||....::||
  Fly   166 KGATAAHLFQ---------MTPSMAKKFTVFSEEA 191

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32485NP_728794.1 CRAL_TRIO 85..219 CDD:279044 27/135 (20%)
CG33514NP_001014558.1 CRAL_TRIO_N 28..74 CDD:215024 16/59 (27%)
SEC14 97..253 CDD:238099 22/110 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45447123
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.