DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32485 and Ttpal

DIOPT Version :9

Sequence 1:NP_728794.1 Gene:CG32485 / 38363 FlyBaseID:FBgn0052485 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_001100007.1 Gene:Ttpal / 296349 RGDID:1305754 Length:343 Species:Rattus norvegicus


Alignment Length:242 Identity:62/242 - (25%)
Similarity:99/242 - (40%) Gaps:37/242 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 EELAPINEQDFKDLKERMKLIVEADPKQYH------NDFSLRRYLRAFK-TTDDAFQAILK---- 57
            |||....|...:|::....::    .|:|.      :|..|.|:|||.| ..|.|.|.::.    
  Rat    46 EELQEKPEWRLRDVQALRDMV----RKEYPYLSTSLDDAFLLRFLRARKFDYDRALQLLVNYHGC 106

  Fly    58 TNKWRETYGVDKLSEMDRSQLDKKARLLRHRD-------CIGRPVIYIPAKNHSSERDIDELTRF 115
            ...|.|.:...:.|.:..........:|.|.|       || ||..:||     |...|.|..|.
  Rat   107 RRSWPEVFSNLRPSALKDVLNSGFLTVLPHTDPRGCHVLCI-RPDRWIP-----SNYPITENIRA 165

  Fly   116 IVYNLEEACKKCFEEV-TDRLCIVFDLAEFSTSCMDY---QLVQNLIWLLGKHFPERLGVCLIIN 176
            |...||:..:.  ||. .:.:.|:.|....|.|...:   .:.:.:|.:|...||.|:....|:|
  Rat   166 IYLTLEKLIQS--EETQVNGVVILADYKGVSLSKASHFGPFIARKVIGILQDGFPIRIKAVHIVN 228

  Fly   177 SPGLFSTIWPAIRVLLDDNTAKKVKFV--ADEAELCQYLIPDILPTD 221
            .|.:|..|:..|:..|.:..|.:. |:  :|.:.|...|..:|||.:
  Rat   229 EPRIFKGIFAIIKPFLKEKIANRF-FLHGSDLSSLHTSLPRNILPKE 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32485NP_728794.1 CRAL_TRIO 85..219 CDD:279044 40/146 (27%)
TtpalNP_001100007.1 CRAL_TRIO_N 57..103 CDD:215024 13/49 (27%)
SEC14 122..278 CDD:238099 42/162 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.