DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32485 and SEC14L3

DIOPT Version :9

Sequence 1:NP_728794.1 Gene:CG32485 / 38363 FlyBaseID:FBgn0052485 Length:222 Species:Drosophila melanogaster
Sequence 2:XP_011528430.1 Gene:SEC14L3 / 266629 HGNCID:18655 Length:412 Species:Homo sapiens


Alignment Length:252 Identity:50/252 - (19%)
Similarity:105/252 - (41%) Gaps:57/252 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 ELAPINEQDFKDLKERMKLIVEADPKQYHNDFSLRRYLRAFKTTDDAFQAIL-KTNKWRETYGVD 68
            :|:|...:.....:|.::.::.|.|..  :|:.|.|:|||........:|:| |..::|:|..:|
Human     7 DLSPKQAETLAKFRENVQDVLPALPNP--DDYFLLRWLRARNFDLQKSEALLRKYMEFRKTMDID 69

  Fly    69 KLSEMDRSQLDKKARLLRHRDCIGRPVIYIPAKNHSSERD-----------ID-----------E 111
            .:.:....::.:|               |:|......:||           :|           :
Human    70 HILDWQPPEVIQK---------------YMPGGLCGYDRDGCPVWYDIIGPLDPKGLLFSVTKQD 119

  Fly   112 LTRFIVYNLEEACKKCFEEVTDRL-------CIVFD-----LAEFSTSCMDYQLVQNLIWLLGKH 164
            |.:..:.:.|....:| :..|:||       .::||     |..|....:  ::.|....||.::
Human   120 LLKTKMRDCERILHEC-DLQTERLGKKIETIVMIFDCEGLGLKHFWKPLV--EVYQEFFGLLEEN 181

  Fly   165 FPERLGVCLIINSPGLFSTIWPAIRVLLDDNTAKKVKFVAD--EAELCQYLIPDILP 219
            :||.|...||:.:..||...:..::..|.::|.:|:..:.:  :..|.:.:.|:.||
Human   182 YPETLKFMLIVKATKLFPVGYNLMKPFLSEDTRRKIIVLGNNWKEGLLKLISPEELP 238

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32485NP_728794.1 CRAL_TRIO 85..219 CDD:279044 30/169 (18%)
SEC14L3XP_011528430.1 CRAL_TRIO_N 13..59 CDD:215024 11/47 (23%)
SEC14 76..245 CDD:214706 33/181 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1133487at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.