DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32485 and SPAC3H8.02

DIOPT Version :9

Sequence 1:NP_728794.1 Gene:CG32485 / 38363 FlyBaseID:FBgn0052485 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_592995.1 Gene:SPAC3H8.02 / 2543637 PomBaseID:SPAC3H8.02 Length:444 Species:Schizosaccharomyces pombe


Alignment Length:232 Identity:72/232 - (31%)
Similarity:101/232 - (43%) Gaps:45/232 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 ERM-KLIVEADPKQYH-----------NDFSLRRYLRAFK-TTDDAFQAILKTNKWRETYGVDKL 70
            ||: |:..|.||:...           .|..|.|:|||.| ..:.|.:..:||..||.       
pombe    96 ERVEKIASEWDPEGLRVCFWDAVNCDDPDGLLLRFLRARKWNVEAALEMFMKTVHWRS------- 153

  Fly    71 SEM-------DRSQLDKK---ARLLRHRDCI-------GRPVIYIPAKNHS----SERDIDELTR 114
            .||       :...|||.   .|.||...|.       .|||.||.|:.|.    |...::.||.
pombe   154 REMNVGEIVCNADHLDKDDDFVRQLRIGKCFIFGEDKHNRPVCYIRARLHKVGDVSPESVERLTV 218

  Fly   115 FIVYNLEEACKKCFEEVTDRLCIVFDLAEFSTSCMDYQLVQNLIWLLGKHFPERLGVCLIINSPG 179
            :::.......|...|..|    :|||:.:||.|.|||..::.:|.....|:||.||.|::..:|.
pombe   219 WVMETARLILKPPIETAT----VVFDMTDFSMSNMDYGPLKFMIKCFEAHYPECLGECIVHKAPW 279

  Fly   180 LFSTIWPAIRVLLDDNTAKKVKFVADEAELCQYLIPD 216
            ||..:|..|:..||.....||||..:..:|.||:.||
pombe   280 LFQGVWSIIKSWLDPVVVSKVKFTRNYRDLQQYINPD 316

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32485NP_728794.1 CRAL_TRIO 85..219 CDD:279044 48/143 (34%)
SPAC3H8.02NP_592995.1 CRAL_TRIO_N <114..145 CDD:281722 8/30 (27%)
CRAL_TRIO 181..324 CDD:279044 46/140 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 77 1.000 Domainoid score I2417
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002427
OrthoInspector 1 1.000 - - otm47394
orthoMCL 1 0.900 - - OOG6_101230
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1928
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.840

Return to query results.
Submit another query.