DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32485 and SPBC365.01

DIOPT Version :9

Sequence 1:NP_728794.1 Gene:CG32485 / 38363 FlyBaseID:FBgn0052485 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_596030.1 Gene:SPBC365.01 / 2541046 PomBaseID:SPBC365.01 Length:355 Species:Schizosaccharomyces pombe


Alignment Length:207 Identity:51/207 - (24%)
Similarity:88/207 - (42%) Gaps:25/207 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 DFSLRRYLRAFK-TTDDAFQAILKTNKWRETYGVDKLSEMDRSQLDK---KARL--LRHRDCIGR 93
            |.:|.|:|:|.| ...|:...:.....||:...:..:.....:.|::   ||.:  :..:|..||
pombe    52 DLTLLRFLKARKFVVTDSSDMLANAIVWRQQANLRSIMVRGENGLNQNFVKASMYFIWGQDKKGR 116

  Fly    94 PVI------YIPAKNHSSERDIDELTRFIVYNLEEACKKCF----EEVTDRLCIVFDLAEFSTSC 148
            .::      :||.||   .:|::||...|:|.:|.|  :.|    :.....:..:.||..||...
pombe   117 AIVFLNLHNFIPPKN---TKDMEELKALILYAMENA--RLFLDSEQNAAKGVLGLVDLTYFSRKN 176

  Fly   149 MDYQLVQNLIWLLGKHFPERLGVCLIINS---PGLFSTIWPAIRVLLDDNTAKKVKFVADEAELC 210
            :|....:........::||.||..||:.|   ..||..:|...:..||.....||.| ...|::.
pombe   177 IDLDFARVFAETFQNYYPEILGQALIVGSGFRMALFEGVWSIGKYFLDPEVRSKVTF-CKPAQVS 240

  Fly   211 QYLIPDILPTDM 222
            .|:....:|..|
pombe   241 GYVDSKYIPLSM 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32485NP_728794.1 CRAL_TRIO 85..219 CDD:279044 37/146 (25%)
SPBC365.01NP_596030.1 CRAL_TRIO_N 26..73 CDD:281722 7/20 (35%)
SEC14 100..257 CDD:214706 41/159 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002427
OrthoInspector 1 1.000 - - otm47394
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.