DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32485 and SPCC23B6.04c

DIOPT Version :9

Sequence 1:NP_728794.1 Gene:CG32485 / 38363 FlyBaseID:FBgn0052485 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_588127.1 Gene:SPCC23B6.04c / 2539120 PomBaseID:SPCC23B6.04c Length:1008 Species:Schizosaccharomyces pombe


Alignment Length:195 Identity:55/195 - (28%)
Similarity:91/195 - (46%) Gaps:28/195 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 RYLRAFK-TTDDAFQAILKTNKWRETYGVDKL--SEMDRSQLDKKARLLRHRDCIGRPVIYI-PA 100
            |||||.| ...:|.:.|:.|..||..:||:.:  .|:.......|..||.: |..|||.:|: ||
pombe   640 RYLRATKWHVSNAKKRIVDTLVWRRHFGVNNMDPDEIQEENATGKQVLLGY-DKDGRPCLYLYPA 703

  Fly   101 KNHSSERDIDELTRFIVYNLEEACKKCFEEV----TDRLCIVFDLAEFST-SCMDYQLVQNLIWL 160
            :.::....:.  .|.:|::||     |..::    .:.|.::.:....|. |.......:.::.:
pombe   704 RQNTKTSPLQ--IRHLVFSLE-----CAIDLMPPGVETLALLINFKSSSNRSNPSVGQGKEVLNI 761

  Fly   161 LGKHFPERLGVCLIINSP----GLFSTIWPAIRVLLDDNTAKKVKFVADEAELCQYLIPDILPTD 221
            |..|:.||||..|:||.|    |.|..|.|    .:|..|.:|:||   ...|.:|:..|.|.::
pombe   762 LQTHYCERLGRALVINIPWAVWGFFKLISP----FIDPITREKLKF---NEPLDRYVPKDQLDSN 819

  Fly   222  221
            pombe   820  819

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32485NP_728794.1 CRAL_TRIO 85..219 CDD:279044 38/143 (27%)
SPCC23B6.04cNP_588127.1 CRAL_TRIO_N 599..657 CDD:281722 7/16 (44%)
CRAL_TRIO 682..823 CDD:279044 41/153 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR45824
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.