DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32485 and Clvs2

DIOPT Version :9

Sequence 1:NP_728794.1 Gene:CG32485 / 38363 FlyBaseID:FBgn0052485 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_780657.1 Gene:Clvs2 / 215890 MGIID:2443223 Length:327 Species:Mus musculus


Alignment Length:239 Identity:57/239 - (23%)
Similarity:98/239 - (41%) Gaps:40/239 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 ERMKLIVEADPKQYHNDFS------LRRYLRAFKTTDDAFQAILKTNKWRETYGVD------KLS 71
            |:.:|.:..:|...|.|..      :.|....|..|||||  ||:..:.|:.:..:      :..
Mouse    14 EKARLELNENPDTLHQDIQEVRDMVITRPDIGFLRTDDAF--ILRFLRARKFHHFEAFRLLAQYF 76

  Fly    72 EMDRSQLD------------KKARL------LRHRDCIGRPVIYIPAKNHSSER-DIDELTRFIV 117
            |..:..||            |:|..      |.:.|..||.::.:.|.|....| .:.::.|.|:
Mouse    77 EYRQQNLDMFKSFKATDPGIKQALKDGFPGGLANLDHYGRKILVLFAANWDQSRYTLVDILRAIL 141

  Fly   118 YNLEEACKKCFEEVTDRLCIVFDLAEFSTSCMDYQLVQNLIWL----LGKHFPERLGVCLIINSP 178
            .:| ||..:..|...:...::.|.:.| |.....:|..|::.|    |...||.|.|....:|.|
Mouse   142 LSL-EAMIEDPELQVNGFVLIIDWSNF-TFKQASKLTPNMLRLAIEGLQDSFPARFGGIHFVNQP 204

  Fly   179 GLFSTIWPAIRVLLDDNTAKKVKFVADEA-ELCQYLIPDILPTD 221
            .....::..||..|.:.|.|::....:.. .|.|.:.|:|||::
Mouse   205 WYIHALYTVIRPFLKEKTRKRIFLHGNNLNSLHQLIHPEILPSE 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32485NP_728794.1 CRAL_TRIO 85..219 CDD:279044 35/139 (25%)
Clvs2NP_780657.1 CRAL_TRIO_N 29..75 CDD:215024 11/47 (23%)
SEC14 106..251 CDD:238099 37/145 (26%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 289..327
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.