DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32485 and Rlbp1

DIOPT Version :9

Sequence 1:NP_728794.1 Gene:CG32485 / 38363 FlyBaseID:FBgn0052485 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_001166954.1 Gene:Rlbp1 / 19771 MGIID:97930 Length:317 Species:Mus musculus


Alignment Length:232 Identity:55/232 - (23%)
Similarity:97/232 - (41%) Gaps:31/232 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 SSEELAPINEQDFKDLKERMKLIVEADPKQYHNDFSLRRYLRAFK-TTDDAFQAILKTNKWRETY 65
            |.||||                :..|:..|..:...|.|::||.| ....|::.:.....:|..|
Mouse    76 SGEELA----------------LAVAERVQARDSAFLLRFIRARKFDVGRAYELLKGYVNFRLQY 124

  Fly    66 G--VDKLSEMDRSQLDKKA---RLLRHRDCIGRPVIYIPAKN-HSSERDIDELTRFIVYNLEEAC 124
            .  .|.|| |:..:...:|   .:|..||..||.|:....:| |..|...||:.:...:.||:..
Mouse   125 PELFDSLS-MEALRCTIEAGYPGVLSSRDKYGRVVMLFNIENWHCEEVTFDEILQAYCFILEKLL 188

  Fly   125 KKCFEEV-TDRLCIVFDLAEFS---TSCMDYQLVQNLIWLLGKHFPERLGVCLIINSPGLFSTIW 185
            :.  ||. .:..|||.:...|:   .:.:....::.::.:|...||.|......|:.|..|:|.:
Mouse   189 EN--EETQINGFCIVENFKGFTMQQAAGLRPSDLKKMVDMLQDSFPARFKAIHFIHQPWYFTTTY 251

  Fly   186 PAIRVLLDDNTAKKVKFVADEAE-LCQYLIPDILPTD 221
            ..::..|.:...::|....|:.: ..|.:..:|||.|
Mouse   252 NVVKPFLKNKLLQRVFVHGDDLDGFFQEIDENILPAD 288

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32485NP_728794.1 CRAL_TRIO 85..219 CDD:279044 32/139 (23%)
Rlbp1NP_001166954.1 CRAL_TRIO_N 60..117 CDD:215024 13/56 (23%)
CRAL_TRIO 143..292 CDD:395525 35/148 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167835996
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.