DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32485 and T03F7.7

DIOPT Version :9

Sequence 1:NP_728794.1 Gene:CG32485 / 38363 FlyBaseID:FBgn0052485 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_872173.1 Gene:T03F7.7 / 179564 WormBaseID:WBGene00011404 Length:394 Species:Caenorhabditis elegans


Alignment Length:248 Identity:53/248 - (21%)
Similarity:109/248 - (43%) Gaps:51/248 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 DFKDLKERMKLIVEADPKQYHNDFSLRRYLRAFK-TTDDAFQAILKTNKWRETYGVDKLSEMD-- 74
            |..:..|::|:.:.:.|.:..:.|...|:|.|.. ..:...|.|::..:.|:..|.:|::::|  
 Worm    14 DILEKAEKLKVSIPSVPDKIDSPFFFARFLNANNGDVEKTRQKIIQLFEHRKLMGYEKINDLDIF 78

  Fly    75 -RSQLDKKARLLRHRDCIGRPVIYIPAKNHS-------------SERDIDELTR-----FIVYN- 119
             ...:.|        ||..|  .:|...|:.             ...||.|:.:     ::::: 
 Worm    79 TTVNIGK--------DCFER--FHISQLNYEVTSKNLHVFVQKMEGTDIKEILKVMPLSYVLHSY 133

  Fly   120 --LEEACKKCFEEV------TDRLCIVFDLAEFSTSCMDY--------QLVQNLIWLLGKHFPER 168
              |:|...:.....      |..:..:.||.  ..:.||:        ||.:.::.:..::|.|.
 Worm   134 FMLQENFSRAMAHTERKTGKTSSVVCILDLK--GLNLMDFMNPLSGPAQLARLVVQVWAEYFSEH 196

  Fly   169 LGVCLIINSPGLFSTIWPAIRVLLDDNTAKKVKFVADEAELCQYLIPDILPTD 221
            |...|:||.||:.|.:|...:.|:|.||.:|:.|:::..:|.:||.|:.:|.:
 Worm   197 LCKLLLINPPGIISVMWQVTKRLVDPNTVEKLAFLSNVEDLKKYLEPEAIPVE 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32485NP_728794.1 CRAL_TRIO 85..219 CDD:279044 37/168 (22%)
T03F7.7NP_872173.1 SEC14 85..254 CDD:214706 39/177 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 57 1.000 Inparanoid score I4042
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm14797
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1928
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.990

Return to query results.
Submit another query.