DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32485 and hpo-28

DIOPT Version :9

Sequence 1:NP_728794.1 Gene:CG32485 / 38363 FlyBaseID:FBgn0052485 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_498232.3 Gene:hpo-28 / 175798 WormBaseID:WBGene00015148 Length:567 Species:Caenorhabditis elegans


Alignment Length:170 Identity:37/170 - (21%)
Similarity:73/170 - (42%) Gaps:8/170 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 HNDFSLRRYLRAFK-TTDDAFQAILKTNKWRETYGVDKLSEMD-RSQLDKKARLLRHRDCIGRPV 95
            |.|:.|.|:|.:.. ..|.|:..:|:..|||..:.||::|.:. :..||.:...|..:|...|.:
 Worm    54 HEDWWLDRFLGSVNYDVDIAYAIMLECLKWRRNFEVDRISLLSLKPLLDNQLMYLHGKDLQNRHM 118

  Fly    96 IYIPAKNHSSERD-IDELTRFIVYNLEEACKKCFEEVTDRLCIVFDLAEFSTSCMDYQLVQNLIW 159
            ::|....:.:..| .::|..|.:.......|.|     ..|.:..|:.......|.:..::.:|.
 Worm   119 LWIMMNKYKNGDDGFEKLFTFWIERHYMEYKGC-----QPLTVFIDMTGTGLKNMSFDAMKFIIH 178

  Fly   160 LLGKHFPERLGVCLIINSPGLFSTIWPAIRVLLDDNTAKK 199
            ....::|..:...||..:|.:.:..|..|...|:.:.|.:
 Worm   179 SSKYYYPNSIESILIFENPAILNASWKVIGSWLESSAASQ 218

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32485NP_728794.1 CRAL_TRIO 85..219 CDD:279044 21/116 (18%)
hpo-28NP_498232.3 SEC14 105..247 CDD:238099 21/119 (18%)
Motile_Sperm <381..460 CDD:279029
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002427
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_101230
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.