DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32485 and C34C12.6

DIOPT Version :9

Sequence 1:NP_728794.1 Gene:CG32485 / 38363 FlyBaseID:FBgn0052485 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_497717.2 Gene:C34C12.6 / 175452 WormBaseID:WBGene00007925 Length:400 Species:Caenorhabditis elegans


Alignment Length:265 Identity:52/265 - (19%)
Similarity:98/265 - (36%) Gaps:57/265 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 SSEELAPINEQDFKDLKERMKLIVE----ADPKQYHNDFSLRRYLRAFKTTDDA----FQAILKT 58
            |||   ||.:.:...:.....::.|    ..|...:.|.:|.|::|.:....:.    |...|.:
 Worm     9 SSE---PITDSERSQINSVRAMLQEKLPDGIPDDVNTDLNLCRWIRGYHGDTEKLVKNFATYLAS 70

  Fly    59 NKWRETYGVD---KLSEM----------------DRSQLDKKARLLRHRDCIGRPVIYIPAKNHS 104
            .|.....|.|   |..|:                ||...|:....|.......:|..:|.....|
 Worm    71 RKAAGFVGNDFAEKFFELPSIAPFLQFIASSRLQDRQWSDEHNAFLFVERAWSQPKEFIKTFKTS 135

  Fly   105 SERDIDELTRFIVYN-------LEEACKKCFEEVTDRLCIVFDLAEFSTSCMDY----------Q 152
                 |.|.....|:       |....|:..::...:..::|||.  :.:..||          .
 Worm   136 -----DYLLHCFGYSEMLQQLILRREKKQSADKGPVQFIVIFDLN--TVNITDYVNPMSGYMKLW 193

  Fly   153 LVQNLIWLLGKHFPERLGVCLIINSPGLFSTIWPAIRVLLDDNTAKKVKFVADEAELC-QYLIPD 216
            .:::.:|  ...|||.:....:.|.|.|...:|...||.|.:...|:::.::|:::|. ::|.|.
 Worm   194 QIRSELW--QDWFPEMVQRIYLTNPPRLLGLLWKVARVFLSEENLKRIEIISDKSDLAGKFLPPW 256

  Fly   217 ILPTD 221
            ::|.:
 Worm   257 LVPKE 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32485NP_728794.1 CRAL_TRIO 85..219 CDD:279044 30/151 (20%)
C34C12.6NP_497717.2 SEC14 91..265 CDD:214706 34/180 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 57 1.000 Inparanoid score I4042
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm14797
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.860

Return to query results.
Submit another query.