DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32485 and F18A11.2

DIOPT Version :9

Sequence 1:NP_728794.1 Gene:CG32485 / 38363 FlyBaseID:FBgn0052485 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_496771.1 Gene:F18A11.2 / 174945 WormBaseID:WBGene00008929 Length:388 Species:Caenorhabditis elegans


Alignment Length:237 Identity:43/237 - (18%)
Similarity:91/237 - (38%) Gaps:73/237 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 NDFSLRRYLRAF-KTTDDAFQAILKTNKWRETYGVDKLS---EMDRSQLDKKARLLRHRDCIGRP 94
            ::|::.|:|.|: ...::|.:|:.:....|:|..::..|   |::..:|:|              
 Worm    28 HEFNVYRWLVAYGNEEEEAAKALKRHLNIRKTIDLNSYSSKTELEEDELNK-------------- 78

  Fly    95 VIYIP----AKNHSSER-----------DIDELT-RFIVYNLEEACKKCFEEVTDRL-------- 135
              |:|    .:||..:.           ||..|. ..:::...:...|..|.|..::        
 Worm    79 --YVPIDVIGQNHQDDNKVLMFERTGKIDISGLVDNVLMHKFMQIKLKMMEGVHQKVVAAERKTG 141

  Fly   136 -----CIVFDLAEFSTSCMDYQLVQ------NLIW-LLGKHFPERLGVCLIINSPGLFSTIWPAI 188
                 ..:.||...|.|   .:|:.      .::| .|..|:|:.|...:|:|:|...:.:..|.
 Worm   142 RQSGGLFIMDLDGISFS---PKLISVLTGPYRIMWGTLFDHYPQLLQKIIIVNAPSFVNVLHQAC 203

  Fly   189 RVLLDDNTAKKVKFVAD--------EAELCQYLIPDILPTDM 222
            ...|.::..:|:...::        .|:.|      .||:|:
 Worm   204 SPFLPEDYKEKIVITSEPAIGAIQKHADKC------FLPSDL 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32485NP_728794.1 CRAL_TRIO 85..219 CDD:279044 28/177 (16%)
F18A11.2NP_496771.1 SEC14 72..244 CDD:214706 33/193 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1133487at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.