DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32485 and ctg-2

DIOPT Version :9

Sequence 1:NP_728794.1 Gene:CG32485 / 38363 FlyBaseID:FBgn0052485 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_001254156.1 Gene:ctg-2 / 174360 WormBaseID:WBGene00011756 Length:408 Species:Caenorhabditis elegans


Alignment Length:242 Identity:56/242 - (23%)
Similarity:104/242 - (42%) Gaps:41/242 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSSEELA----PINEQDFKDLKE-RMKLIVEAD-PKQYHNDFSLRRYLRAFKTTDDAFQAILKTN 59
            :|.|.::    .|.|.|.|.|.| |.::..|.: .|:|.:||||.|:|..:....|.....:|.:
 Worm     8 LSGERMSTSTGEITESDRKLLDELRKRIHKELELVKEYDDDFSLMRWLIGWDRKIDVVVPKIKFS 72

  Fly    60 KWRETYGVDKLSEMDRSQLDKKARLLRHRDCIGRPVIYIPAKNHSSERDIDELTRFIVYNLEEA- 123
             .|..:.:. |.:.|.|.|:|.|:  :..|| ..|:.|:|......:.:.:.::..::.:|:.| 
 Worm    73 -LRAIHALG-LDQEDLSTLEKVAQ--KCDDC-SVPLRYLPGSLIGLDHENNVVSLQMIGHLDAAG 132

  Fly   124 ------------------------CKKCFEEVTDRL--CIVFDLAEFSTSCMD---YQLVQNLIW 159
                                    .:|..:|....|  .::|||...|...:|   .::|..::.
 Worm   133 LMPATRNSDLYRMRIAESEGVMQIIRKMEKEQGKPLGTSVIFDLDGLSMVQIDLAALKVVTTMLS 197

  Fly   160 LLGKHFPERLGVCLIINSPGLFSTIWPAIRVLLDDNTAKKVKFVADE 206
            .|.:.||:.:....|:|:|.....:|..|...|...|.:|||.:.::
 Worm   198 QLQEMFPDVIRKIFIVNTPTFIQVLWSMISPCLAKQTQQKVKILGND 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32485NP_728794.1 CRAL_TRIO 85..219 CDD:279044 29/152 (19%)
ctg-2NP_001254156.1 SEC14 98..267 CDD:214706 29/148 (20%)
EMP24_GP25L 331..>405 CDD:279450
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1133487at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.