Sequence 1: | NP_728794.1 | Gene: | CG32485 / 38363 | FlyBaseID: | FBgn0052485 | Length: | 222 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001254156.1 | Gene: | ctg-2 / 174360 | WormBaseID: | WBGene00011756 | Length: | 408 | Species: | Caenorhabditis elegans |
Alignment Length: | 242 | Identity: | 56/242 - (23%) |
---|---|---|---|
Similarity: | 104/242 - (42%) | Gaps: | 41/242 - (16%) |
- Green bases have known domain annotations that are detailed below.
Fly 1 MSSEELA----PINEQDFKDLKE-RMKLIVEAD-PKQYHNDFSLRRYLRAFKTTDDAFQAILKTN 59
Fly 60 KWRETYGVDKLSEMDRSQLDKKARLLRHRDCIGRPVIYIPAKNHSSERDIDELTRFIVYNLEEA- 123
Fly 124 ------------------------CKKCFEEVTDRL--CIVFDLAEFSTSCMD---YQLVQNLIW 159
Fly 160 LLGKHFPERLGVCLIINSPGLFSTIWPAIRVLLDDNTAKKVKFVADE 206 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG32485 | NP_728794.1 | CRAL_TRIO | 85..219 | CDD:279044 | 29/152 (19%) |
ctg-2 | NP_001254156.1 | SEC14 | 98..267 | CDD:214706 | 29/148 (20%) |
EMP24_GP25L | 331..>405 | CDD:279450 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D1133487at2759 | |
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.920 |