DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32485 and ctg-1

DIOPT Version :9

Sequence 1:NP_728794.1 Gene:CG32485 / 38363 FlyBaseID:FBgn0052485 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_491993.1 Gene:ctg-1 / 172431 WormBaseID:WBGene00010370 Length:383 Species:Caenorhabditis elegans


Alignment Length:214 Identity:50/214 - (23%)
Similarity:96/214 - (44%) Gaps:23/214 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 INEQDFKDLKERMKLIVEADPKQYHNDFSLRRYLRAFK-TTDDAFQAILKTNKWRETYGVDKLSE 72
            |.:|..:||:   .::.:.|..   ||..:.|:|||.: ..|:..:::.|...:|..:.:||:.:
 Worm    12 IEQQTIRDLR---SIVPQIDNL---NDGYVLRWLRAKEGRFDETAESLKKHVTFRNAWHLDKIEQ 70

  Fly    73 MDRSQ-LDKKARLLRHRDCIGRPVIYIPAKNHSSE---RDIDEL--TRFIVYNLEEACKKCFEEV 131
            ....: |:|........|..|||::.....|...|   |.:..|  .:|.:..:|:..|.|.|:.
 Worm    71 WTPPECLEKYCGYGLLGDTEGRPILMSLLGNVDVEGLLRSVASLDYIKFSLAAIEKGMKLCEEKA 135

  Fly   132 T------DRLCIVFDLAEFST---SCMDY-QLVQNLIWLLGKHFPERLGVCLIINSPGLFSTIWP 186
            .      :::.:||||...::   ||..: .....|:.|...|:|..|...|||.:|.:....:.
 Worm   136 KESGRPFEQMTLVFDLENITSAHFSCKQFASSFTTLVSLFQDHYPLFLRKILIIRAPEMARIAYA 200

  Fly   187 AIRVLLDDNTAKKVKFVAD 205
            :|..:|.|...:.|:..::
 Worm   201 SITAILQDPITRLVEMPSE 219

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32485NP_728794.1 CRAL_TRIO 85..219 CDD:279044 32/136 (24%)
ctg-1NP_491993.1 SEC14 73..244 CDD:214706 34/147 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1133487at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.