DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32485 and CLVS1

DIOPT Version :9

Sequence 1:NP_728794.1 Gene:CG32485 / 38363 FlyBaseID:FBgn0052485 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_775790.1 Gene:CLVS1 / 157807 HGNCID:23139 Length:354 Species:Homo sapiens


Alignment Length:237 Identity:52/237 - (21%)
Similarity:99/237 - (41%) Gaps:36/237 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 ERMKLIVEADPKQYHNDFS---------------------LRRYLRAFKTTD-DAFQAILKTNKW 61
            |:.:|.:..:|...|.|..                     :.|:|||.|... |||:.:.:..::
Human    36 EKARLELNENPDVLHQDIQQVRDMIITRPDIGFLRTDDAFILRFLRARKFHQADAFRLLAQYFQY 100

  Fly    62 RETYGVDKLSE-------MDRSQLDKKARLLRHRDCIGRPVIYIPAKNHSSERD-IDELTRFIVY 118
            |: ..:|....       :.|:.:|....:|.:||..||.::.:.|.|....|: ..::.|.|:.
Human   101 RQ-LNLDMFKNFKADDPGIKRALIDGFPGVLENRDHYGRKILLLFAANWDQSRNSFTDILRAILL 164

  Fly   119 NLEEACKKCFEEVTDRLCIVFDLAEFS---TSCMDYQLVQNLIWLLGKHFPERLGVCLIINSPGL 180
            :||...:....::...:.|: |.:.||   .|.:...:::..|..|...||.|.|....:|.|..
Human   165 SLEVLIEDPELQINGFILII-DWSNFSFKQASKLTPSILKLAIEGLQDSFPARFGGVHFVNQPWY 228

  Fly   181 FSTIWPAIRVLLDDNTAKKVKFVADEA-ELCQYLIPDILPTD 221
            ...::..|:..|.|.|.|::....:.. .|.|.:.|:.||::
Human   229 IHALYTLIKPFLKDKTRKRIFLHGNNLNSLHQLIHPEFLPSE 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32485NP_728794.1 CRAL_TRIO 85..219 CDD:279044 33/138 (24%)
CLVS1NP_775790.1 CRAL_TRIO_N 51..97 CDD:215024 9/45 (20%)
CRAL_TRIO 125..274 CDD:306996 35/147 (24%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 333..354
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.